SimulationCraft 902-01

for World of Warcraft 9.0.2.36599 Live (wow build level 36599)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Forgelite : 16845 dps, 4902 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16845.0 16845.0 24.2 / 0.144% 1540.2 / 9.1% 8.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
1995.6 1895.6 Mana 0.00% 49.5 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Forgelite 16845
Arcane Barrage 5693 33.8% 55.2 5.42sec 30902 24799 Direct 275.4 5178 10419 6190 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.16 275.43 0.00 0.00 1.2461 0.0000 1704414.96 1704414.96 0.00% 24799.07 24799.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 222.17 170 284 5177.86 2082 32682 5166.22 4511 5629 1150061 1150061 0.00%
crit 19.33% 53.25 26 82 10419.06 4164 60336 10385.46 7774 14096 554354 554354 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.16
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 621 3.7% 58.9 4.75sec 3147 0 Direct 294.6 528 1055 629 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.92 294.60 0.00 0.00 0.0000 0.0000 185440.70 185440.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 237.79 176 307 527.85 316 664 527.48 486 572 125514 125514 0.00%
crit 19.28% 56.81 27 88 1055.01 633 1329 1054.04 929 1160 59927 59927 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7655 45.4% 148.3 1.98sec 15426 12418 Direct 741.3 2588 5171 3086 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.26 741.32 0.00 0.00 1.2423 0.0000 2287167.16 2287167.16 0.00% 12417.84 12417.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 598.45 460 732 2588.17 1958 5756 2587.94 2503 2675 1548564 1548564 0.00%
crit 19.27% 142.87 96 201 5170.87 3916 11512 5170.76 4686 5607 738604 738604 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:148.26
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1396) 0.0% (8.3%) 12.7 24.15sec 32781 26319

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.73 0.00 0.00 0.00 1.2456 0.0000 0.00 0.00 0.00% 26318.70 26318.70

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.73
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1396 8.3% 63.5 24.15sec 6566 0 Direct 63.5 5502 11026 6567 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.54 63.54 0.00 0.00 0.0000 0.0000 417204.03 417204.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 51.29 32 69 5502.35 3869 8938 5500.20 5020 5899 282188 282188 0.00%
crit 19.27% 12.25 2 24 11025.64 7739 17876 11022.60 7739 15493 135016 135016 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.76sec 1384 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.76sec 1384 0 Direct 14.7 1164 2327 1385 19.0%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.69 14.69 0.00 0.00 0.0000 0.0000 20338.94 20338.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.03% 11.90 5 19 1163.53 1164 1164 1163.53 1164 1164 13852 13852 0.00%
crit 18.97% 2.79 0 11 2327.06 2327 2327 2185.34 0 2327 6487 6487 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1774 19.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1774.48 1774.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.16% 0.80 0 1 1480.68 1481 1481 1186.87 0 1481 1187 1187 0.00%
crit 19.84% 0.20 0 1 2961.35 2961 2961 587.62 0 2961 588 588 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.1%) 1.0 0.00sec 6111 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 153  / 21 0.1% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6111.11 6111.11 0.00% 51.89 51.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 72.42 60 84 56.78 43 60 56.79 56 59 4113 4113 0.00%
crit 19.53% 17.58 6 30 113.72 86 120 113.68 100 120 1998 1998 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 189 1.1% 9.2 34.07sec 6128 4813 Direct 9.2 3034 6159 3646 19.6%
Periodic 60.0 320 638 381 19.3% 6.1%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.22 9.22 60.02 60.02 1.2734 1.5110 56473.77 56473.77 0.00% 551.36 4812.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.38% 7.41 1 11 3034.29 2693 5655 3033.60 2693 4093 22464 22464 0.00%
crit 19.62% 1.81 0 7 6158.99 5386 11310 5360.82 0 11310 11146 11146 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.70% 48.44 30 64 319.61 34 501 319.08 281 353 15476 15476 0.00%
crit 19.30% 11.58 1 23 637.58 68 1003 635.84 402 1003 7387 7387 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.53
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.75
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.98
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (1180) 0.0% (7.0%) 5.9 54.81sec 59765 47605

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.89 0.00 0.00 0.00 1.2556 0.0000 0.00 0.00 0.00% 47605.06 47605.06

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.91
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1180 7.0% 5.9 54.67sec 59765 0 Direct 29.4 11970 0 11970 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.89 29.42 0.00 0.00 0.0000 0.0000 352134.66 352134.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 29.42 20 35 11970.14 85 56174 11977.84 8776 14942 352135 352135 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20424.41
  • base_dd_max:20424.41
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
pet - bron 75 / 14
melee 75 0.1% 17.4 9.02sec 245 189 Direct 17.4 205 411 245 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 0.00 0.00 1.2990 0.0000 4266.58 6094.39 29.99% 188.74 188.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 14.03 5 20 205.28 176 247 205.27 182 239 2880 4113 29.99%
crit 19.38% 3.37 0 10 411.32 353 494 401.27 0 494 1387 1981 29.28%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Kyrian_Forgelite
Arcane Power 2.8 131.19sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.78
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 262.11sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.78
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.0 157.37sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.01 0.00 6.01 0.00 4.3138 0.7224 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:1.01
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.7 52.86sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.73 0.00 0.00 0.00 1.2542 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.77
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.70sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.72
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
pet - bron
Anima Cannon 7.6 22.39sec

Stats Details: Anima Cannon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Anima Cannon

  • id:332525
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:8.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332525
  • name:Anima Cannon
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:7.61
Vitalizing Bolt (goliath_support) 13.3 12.06sec

Stats Details: Goliath Support

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 13.30 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Goliath Support

  • id:332526
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:4.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite_bron
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332526
  • name:Vitalizing Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:13.33
Smash 7.5 22.43sec

Stats Details: Smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.51 0.00 0.00 0.00 2.1659 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Smash

  • id:341163
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:3.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:341163
  • name:Smash
  • school:physical
  • tooltip:
  • description:Attacks the ground with a heavy smash, inflicting Arcane damage to all enemies in a cone in front of the caster.

Action Priority List

    default
    [ ]:7.61

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.9 174.5 5.3sec 1.3sec 3.9sec 72.18% 0.00% 25.5 (25.6) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.73%
  • arcane_charge_2:16.05%
  • arcane_charge_3:16.04%
  • arcane_charge_4:21.36%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 131.5sec 131.5sec 14.7sec 13.60% 0.00% 0.0 (0.0) 2.6

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.2s / 138.9s
  • trigger_min/max:120.2s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:13.60%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 262.8sec 262.8sec 11.7sec 6.87% 23.17% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:240.6s / 272.0s
  • trigger_min/max:240.6s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:6.87%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bron's Call to Action 3.0 220.0 119.0sec 1.3sec 98.7sec 99.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_brons_call_to_action
  • max_stacks:89
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:109.2s / 134.1s
  • trigger_min/max:0.9s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 132.8s

Stack Uptimes

  • brons_call_to_action_1:1.43%
  • brons_call_to_action_2:1.25%
  • brons_call_to_action_3:1.32%
  • brons_call_to_action_4:1.37%
  • brons_call_to_action_5:1.20%
  • brons_call_to_action_6:1.60%
  • brons_call_to_action_7:1.17%
  • brons_call_to_action_8:1.16%
  • brons_call_to_action_9:1.15%
  • brons_call_to_action_10:1.15%
  • brons_call_to_action_11:1.15%
  • brons_call_to_action_12:1.15%
  • brons_call_to_action_13:1.21%
  • brons_call_to_action_14:1.27%
  • brons_call_to_action_15:1.12%
  • brons_call_to_action_16:1.12%
  • brons_call_to_action_17:1.19%
  • brons_call_to_action_18:1.28%
  • brons_call_to_action_19:1.73%
  • brons_call_to_action_20:1.28%
  • brons_call_to_action_21:1.13%
  • brons_call_to_action_22:1.11%
  • brons_call_to_action_23:1.08%
  • brons_call_to_action_24:1.07%
  • brons_call_to_action_25:1.11%
  • brons_call_to_action_26:1.06%
  • brons_call_to_action_27:1.06%
  • brons_call_to_action_28:1.05%
  • brons_call_to_action_29:1.06%
  • brons_call_to_action_30:1.05%
  • brons_call_to_action_31:1.04%
  • brons_call_to_action_32:1.39%
  • brons_call_to_action_33:1.05%
  • brons_call_to_action_34:1.04%
  • brons_call_to_action_35:1.04%
  • brons_call_to_action_36:1.07%
  • brons_call_to_action_37:1.11%
  • brons_call_to_action_38:1.14%
  • brons_call_to_action_39:1.03%
  • brons_call_to_action_40:1.04%
  • brons_call_to_action_41:1.11%
  • brons_call_to_action_42:1.36%
  • brons_call_to_action_43:1.18%
  • brons_call_to_action_44:1.13%
  • brons_call_to_action_45:1.12%
  • brons_call_to_action_46:1.10%
  • brons_call_to_action_47:1.07%
  • brons_call_to_action_48:1.10%
  • brons_call_to_action_49:1.06%
  • brons_call_to_action_50:1.05%
  • brons_call_to_action_51:1.05%
  • brons_call_to_action_52:1.05%
  • brons_call_to_action_53:1.13%
  • brons_call_to_action_54:1.05%
  • brons_call_to_action_55:1.05%
  • brons_call_to_action_56:1.02%
  • brons_call_to_action_57:1.02%
  • brons_call_to_action_58:1.03%
  • brons_call_to_action_59:1.50%
  • brons_call_to_action_60:1.13%
  • brons_call_to_action_61:1.01%
  • brons_call_to_action_62:1.05%
  • brons_call_to_action_63:1.00%
  • brons_call_to_action_64:1.01%
  • brons_call_to_action_65:1.21%
  • brons_call_to_action_66:0.99%
  • brons_call_to_action_67:1.02%
  • brons_call_to_action_68:0.98%
  • brons_call_to_action_69:0.99%
  • brons_call_to_action_70:0.99%
  • brons_call_to_action_71:1.05%
  • brons_call_to_action_72:1.02%
  • brons_call_to_action_73:1.02%
  • brons_call_to_action_74:1.11%
  • brons_call_to_action_75:1.01%
  • brons_call_to_action_76:1.12%
  • brons_call_to_action_77:1.02%
  • brons_call_to_action_78:0.94%
  • brons_call_to_action_79:1.08%
  • brons_call_to_action_80:0.92%
  • brons_call_to_action_81:0.92%
  • brons_call_to_action_82:1.34%
  • brons_call_to_action_83:0.98%
  • brons_call_to_action_84:1.03%
  • brons_call_to_action_85:0.93%
  • brons_call_to_action_86:0.90%
  • brons_call_to_action_87:0.92%
  • brons_call_to_action_88:1.10%
  • brons_call_to_action_89:0.98%

Spelldata

  • id:332514
  • name:Bron's Call to Action
  • tooltip:Bron arrives in ${{$332514u=89}+1-$w1} damaging or healing spells or abilities.
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}
  • max_stacks:89
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 23.6 0.2 12.2sec 12.2sec 2.1sec 16.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.09%
  • clearcasting_2:0.24%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.0 0.0 164.0sec 164.0sec 4.3sec 1.46% 0.00% 4.0 (4.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:108.9s / 233.0s
  • trigger_min/max:108.9s / 233.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.46%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.48%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.5 0.0 36.6sec 36.6sec 14.6sec 41.71% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 55.3s
  • trigger_min/max:16.8s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:41.71%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.47% 0.82% 6.85% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.911120.053239.917
Evocation163.04318.858333.949223.197122.881352.903
Rune of Power8.5821.13629.92351.56631.83778.692
Touch of the Magi7.1451.13929.92044.47230.52976.157
Arcane Power8.1790.22418.92723.4402.69234.301
Arcane Barrage2.9230.0039.587162.397129.036197.070
Arcane Orb4.0670.01611.78952.29640.05368.785
Radiant Spark2.4280.00025.18723.1709.69158.620

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Forgelite
mana_regen Mana 620.08 367240.29 64.81% 592.25 10997.31 2.91%
Evocation Mana 48.11 48444.84 8.55% 1007.04 0.00 0.00%
Mana Gem Mana 2.72 17252.47 3.04% 6337.14 0.00 0.00%
Arcane Barrage Mana 55.16 133727.79 23.60% 2424.30 6098.75 4.36%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1895.63 1995.62 17078.3 33481.0 0.7 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Forgelite
arcane_explosion Mana 148.3 565967.1 3817.4 3817.3 4.0
arcane_orb Mana 12.7 5688.6 446.8 447.0 73.3
radiant_spark Mana 9.2 9074.5 984.8 984.7 6.2
touch_of_the_magi Mana 5.9 14734.0 2500.0 2500.7 23.9

Statistics & Data Analysis

Fight Length
Kyrian_Forgelite Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Kyrian_Forgelite Damage Per Second
Count 1018
Mean 16845.01
Minimum 15668.20
Maximum 18115.12
Spread ( max - min ) 2446.92
Range [ ( max - min ) / 2 * 100% ] 7.26%
Standard Deviation 393.9207
5th Percentile 16199.17
95th Percentile 17491.89
( 95th Percentile - 5th Percentile ) 1292.72
Mean Distribution
Standard Deviation 12.3462
95.00% Confidence Interval ( 16820.81 - 16869.21 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2101
0.1 Scale Factor Error with Delta=300 1325
0.05 Scale Factor Error with Delta=300 5299
0.01 Scale Factor Error with Delta=300 132466
Priority Target DPS
Kyrian_Forgelite Priority Target Damage Per Second
Count 1018
Mean 4902.48
Minimum 4356.98
Maximum 5447.13
Spread ( max - min ) 1090.15
Range [ ( max - min ) / 2 * 100% ] 11.12%
Standard Deviation 177.1411
5th Percentile 4617.54
95th Percentile 5203.32
( 95th Percentile - 5th Percentile ) 585.79
Mean Distribution
Standard Deviation 5.5519
95.00% Confidence Interval ( 4891.59 - 4913.36 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5016
0.1 Scale Factor Error with Delta=300 268
0.05 Scale Factor Error with Delta=300 1072
0.01 Scale Factor Error with Delta=300 26787
DPS(e)
Kyrian_Forgelite Damage Per Second (Effective)
Count 1018
Mean 16845.01
Minimum 15668.20
Maximum 18115.12
Spread ( max - min ) 2446.92
Range [ ( max - min ) / 2 * 100% ] 7.26%
Damage
Kyrian_Forgelite Damage
Count 1018
Mean 5024948.70
Minimum 3762390.27
Maximum 6097080.84
Spread ( max - min ) 2334690.57
Range [ ( max - min ) / 2 * 100% ] 23.23%
DTPS
Kyrian_Forgelite Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Forgelite Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Forgelite Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Forgelite Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Forgelite Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Forgelite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_ForgeliteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Forgelite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.53 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.75 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.98 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.91 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.78 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.77 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.73 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 148.26 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.16 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 1.01 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.72 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.78 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqtqrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqtrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqsqrqqqqrmorprqqqqrqjqqqrqqqqrprqqqqrqqqqrqqqqtrkmnvrpr

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.309 aoe m touch_of_the_magi Fluffy_Pillow 62380.3/63371: 98% mana bloodlust
0:02.316 aoe n arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), clearcasting
0:02.316 shared_cds u potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power
0:02.316 shared_cds v berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:02.316 aoe r arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:03.230 aoe p arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.144 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:05.060 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:05.974 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.888 aoe q arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.801 aoe q arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.715 aoe r arcane_barrage Fluffy_Pillow 59345.5/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.631 aoe q arcane_explosion Fluffy_Pillow 63041.3/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.547 aoe q arcane_explosion Fluffy_Pillow 61702.2/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.462 aoe q arcane_explosion Fluffy_Pillow 60361.9/63371: 95% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.376 aoe q arcane_explosion Fluffy_Pillow 59020.4/63371: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.292 aoe r arcane_barrage Fluffy_Pillow 57681.3/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.206 aoe q arcane_explosion Fluffy_Pillow 61374.6/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.120 aoe q arcane_explosion Fluffy_Pillow 60033.0/63371: 95% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.126 aoe q arcane_explosion Fluffy_Pillow 58808.1/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.132 aoe q arcane_explosion Fluffy_Pillow 57583.1/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:18.137 aoe o rune_of_power Fluffy_Pillow 56356.9/63371: 89% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.142 aoe r arcane_barrage Fluffy_Pillow 57630.6/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.147 aoe q arcane_explosion Fluffy_Pillow 61439.3/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.156 aoe q arcane_explosion Fluffy_Pillow 57718.1/63371: 91% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.162 aoe q arcane_explosion Fluffy_Pillow 53993.1/63371: 85% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.168 shared_cds t use_mana_gem Kyrian_Forgelite 50268.2/63371: 79% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.168 aoe q arcane_explosion Fluffy_Pillow 56605.3/63371: 89% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.177 aoe r arcane_barrage Fluffy_Pillow 52884.1/63371: 83% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:25.182 aoe p arcane_orb Fluffy_Pillow 56692.8/63371: 89% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.187 aoe r arcane_barrage Fluffy_Pillow 57466.5/63371: 91% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.195 aoe q arcane_explosion Fluffy_Pillow 61279.0/63371: 97% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:28.202 aoe q arcane_explosion Fluffy_Pillow 62555.3/63371: 99% mana bloodlust, arcane_charge, rune_of_power
0:29.208 aoe q arcane_explosion Fluffy_Pillow 58830.3/63371: 93% mana bloodlust, arcane_charge(2), rune_of_power
0:30.214 aoe q arcane_explosion Fluffy_Pillow 55105.3/63371: 87% mana bloodlust, arcane_charge(3), rune_of_power
0:31.222 aoe r arcane_barrage Fluffy_Pillow 51382.9/63371: 81% mana bloodlust, arcane_charge(4), rune_of_power
0:32.229 aoe j radiant_spark Fluffy_Pillow 55194.1/63371: 87% mana bloodlust, rune_of_power
0:33.236 aoe q arcane_explosion Fluffy_Pillow 55470.4/63371: 88% mana bloodlust, rune_of_power
0:34.242 aoe q arcane_explosion Fluffy_Pillow 51745.4/63371: 82% mana bloodlust, arcane_charge, clearcasting
0:35.249 aoe q arcane_explosion Fluffy_Pillow 53021.7/63371: 84% mana bloodlust, arcane_charge(2)
0:36.254 aoe q arcane_explosion Fluffy_Pillow 49295.5/63371: 78% mana bloodlust, arcane_charge(3)
0:37.261 aoe r arcane_barrage Fluffy_Pillow 45571.8/63371: 72% mana bloodlust, arcane_charge(4)
0:38.266 aoe q arcane_explosion Fluffy_Pillow 49380.4/63371: 78% mana bloodlust
0:39.273 aoe q arcane_explosion Fluffy_Pillow 45656.7/63371: 72% mana bloodlust, arcane_charge, clearcasting
0:40.280 aoe q arcane_explosion Fluffy_Pillow 46933.0/63371: 74% mana bloodlust, arcane_charge(2)
0:41.288 aoe q arcane_explosion Fluffy_Pillow 43210.5/63371: 68% mana arcane_charge(3)
0:42.594 aoe r arcane_barrage Fluffy_Pillow 39865.8/63371: 63% mana arcane_charge(4)
0:43.902 aoe q arcane_explosion Fluffy_Pillow 44058.5/63371: 70% mana
0:45.210 aoe q arcane_explosion Fluffy_Pillow 40716.3/63371: 64% mana arcane_charge
0:46.516 aoe q arcane_explosion Fluffy_Pillow 37371.5/63371: 59% mana arcane_charge(2)
0:47.825 aoe q arcane_explosion Fluffy_Pillow 34030.6/63371: 54% mana arcane_charge(3)
0:49.132 aoe r arcane_barrage Fluffy_Pillow 30687.1/63371: 48% mana arcane_charge(4), clearcasting
0:50.439 aoe p arcane_orb Fluffy_Pillow 34878.5/63371: 55% mana clearcasting
0:51.745 aoe r arcane_barrage Fluffy_Pillow 36033.8/63371: 57% mana arcane_charge(4), clearcasting
0:53.050 aoe q arcane_explosion Fluffy_Pillow 40222.6/63371: 63% mana clearcasting
0:54.356 aoe q arcane_explosion Fluffy_Pillow 41877.9/63371: 66% mana arcane_charge
0:55.662 aoe q arcane_explosion Fluffy_Pillow 38533.1/63371: 61% mana arcane_charge(2), clearcasting
0:56.967 aoe q arcane_explosion Fluffy_Pillow 40187.1/63371: 63% mana arcane_charge(3)
0:58.276 aoe r arcane_barrage Fluffy_Pillow 36846.2/63371: 58% mana arcane_charge(4)
0:59.584 aoe q arcane_explosion Fluffy_Pillow 41038.8/63371: 65% mana
1:00.890 aoe q arcane_explosion Fluffy_Pillow 37694.1/63371: 59% mana arcane_charge
1:02.195 aoe q arcane_explosion Fluffy_Pillow 34348.1/63371: 54% mana arcane_charge(2)
1:03.503 aoe q arcane_explosion Fluffy_Pillow 31005.9/63371: 49% mana arcane_charge(3)
1:04.811 aoe r arcane_barrage Fluffy_Pillow 27663.7/63371: 44% mana arcane_charge(4)
1:06.117 aoe k radiant_spark Fluffy_Pillow 31853.8/63371: 50% mana
1:07.424 aoe m touch_of_the_magi Fluffy_Pillow 32510.3/63371: 51% mana
1:08.730 aoe o rune_of_power Fluffy_Pillow 31665.6/63371: 50% mana arcane_charge(4)
1:10.037 aoe r arcane_barrage Fluffy_Pillow 33322.1/63371: 53% mana arcane_charge(4), rune_of_power
1:11.342 aoe p arcane_orb Fluffy_Pillow 37511.0/63371: 59% mana rune_of_power
1:12.648 aoe r arcane_barrage Fluffy_Pillow 38666.2/63371: 61% mana arcane_charge(4), rune_of_power
1:13.953 aoe q arcane_explosion Fluffy_Pillow 42855.1/63371: 68% mana rune_of_power
1:15.258 aoe q arcane_explosion Fluffy_Pillow 39509.1/63371: 62% mana arcane_charge, rune_of_power
1:16.565 aoe q arcane_explosion Fluffy_Pillow 36165.6/63371: 57% mana arcane_charge(2), rune_of_power
1:17.871 aoe q arcane_explosion Fluffy_Pillow 32820.9/63371: 52% mana arcane_charge(3), rune_of_power
1:19.178 aoe r arcane_barrage Fluffy_Pillow 29477.4/63371: 47% mana arcane_charge(4), rune_of_power
1:20.484 aoe q arcane_explosion Fluffy_Pillow 33667.5/63371: 53% mana rune_of_power
1:21.790 aoe q arcane_explosion Fluffy_Pillow 30322.8/63371: 48% mana arcane_charge, rune_of_power
1:23.099 aoe q arcane_explosion Fluffy_Pillow 26981.9/63371: 43% mana arcane_charge(2), rune_of_power
1:24.405 aoe q arcane_explosion Fluffy_Pillow 23637.1/63371: 37% mana arcane_charge(3), rune_of_power
1:25.711 aoe r arcane_barrage Fluffy_Pillow 20292.4/63371: 32% mana arcane_charge(4)
1:27.018 aoe q arcane_explosion Fluffy_Pillow 24483.8/63371: 39% mana
1:28.324 aoe q arcane_explosion Fluffy_Pillow 21139.0/63371: 33% mana arcane_charge
1:29.631 aoe q arcane_explosion Fluffy_Pillow 17795.6/63371: 28% mana arcane_charge(2), clearcasting
1:30.937 aoe q arcane_explosion Fluffy_Pillow 19450.8/63371: 31% mana arcane_charge(3)
1:32.245 aoe r arcane_barrage Fluffy_Pillow 16108.6/63371: 25% mana arcane_charge(4)
1:33.551 aoe p arcane_orb Fluffy_Pillow 20298.7/63371: 32% mana
1:34.859 aoe r arcane_barrage Fluffy_Pillow 21456.5/63371: 34% mana arcane_charge(4)
1:36.165 aoe q arcane_explosion Fluffy_Pillow 25646.7/63371: 40% mana
1:37.473 aoe j radiant_spark Fluffy_Pillow 22304.4/63371: 35% mana arcane_charge
1:38.778 aoe q arcane_explosion Fluffy_Pillow 22958.4/63371: 36% mana arcane_charge
1:40.085 aoe q arcane_explosion Fluffy_Pillow 19615.0/63371: 31% mana arcane_charge(2), clearcasting
1:41.390 aoe q arcane_explosion Fluffy_Pillow 21269.0/63371: 34% mana arcane_charge(3)
1:42.696 aoe r arcane_barrage Fluffy_Pillow 17924.2/63371: 28% mana arcane_charge(4)
1:44.004 aoe q arcane_explosion Fluffy_Pillow 22116.9/63371: 35% mana
1:45.312 aoe q arcane_explosion Fluffy_Pillow 18774.7/63371: 30% mana arcane_charge, clearcasting
1:46.621 aoe q arcane_explosion Fluffy_Pillow 20433.7/63371: 32% mana arcane_charge(2)
1:47.929 aoe q arcane_explosion Fluffy_Pillow 17091.5/63371: 27% mana arcane_charge(3)
1:49.235 aoe r arcane_barrage Fluffy_Pillow 13746.8/63371: 22% mana arcane_charge(4), clearcasting
1:50.542 aoe q arcane_explosion Fluffy_Pillow 17938.2/63371: 28% mana clearcasting, brons_call_to_action
1:51.850 aoe q arcane_explosion Fluffy_Pillow 19596.0/63371: 31% mana arcane_charge, brons_call_to_action(2)
1:53.156 aoe q arcane_explosion Fluffy_Pillow 16251.2/63371: 26% mana arcane_charge(2), brons_call_to_action(3)
1:54.461 aoe q arcane_explosion Fluffy_Pillow 12905.2/63371: 20% mana arcane_charge(3), clearcasting, brons_call_to_action(4)
1:55.770 aoe r arcane_barrage Fluffy_Pillow 14564.3/63371: 23% mana arcane_charge(4), brons_call_to_action(5)
1:57.077 aoe m touch_of_the_magi Fluffy_Pillow 18755.7/63371: 30% mana brons_call_to_action(6)
1:58.384 aoe o rune_of_power Fluffy_Pillow 17912.2/63371: 28% mana arcane_charge(4), brons_call_to_action(7)
1:59.689 aoe r arcane_barrage Fluffy_Pillow 19566.2/63371: 31% mana arcane_charge(4), rune_of_power, brons_call_to_action(8)
2:00.995 aoe p arcane_orb Fluffy_Pillow 23756.3/63371: 37% mana rune_of_power, brons_call_to_action(8)
2:02.301 aoe r arcane_barrage Fluffy_Pillow 24911.6/63371: 39% mana arcane_charge(4), rune_of_power, brons_call_to_action(9)
2:03.607 aoe q arcane_explosion Fluffy_Pillow 29101.7/63371: 46% mana rune_of_power, brons_call_to_action(10)
2:04.914 aoe q arcane_explosion Fluffy_Pillow 25758.2/63371: 41% mana arcane_charge, clearcasting, rune_of_power, brons_call_to_action(11)
2:06.220 aoe q arcane_explosion Fluffy_Pillow 27413.5/63371: 43% mana arcane_charge(2), rune_of_power, brons_call_to_action(12)
2:07.526 aoe q arcane_explosion Fluffy_Pillow 24068.8/63371: 38% mana arcane_charge(3), rune_of_power, brons_call_to_action(13)
2:08.833 aoe r arcane_barrage Fluffy_Pillow 20725.3/63371: 33% mana arcane_charge(4), rune_of_power, brons_call_to_action(14)
2:10.139 aoe q arcane_explosion Fluffy_Pillow 24915.4/63371: 39% mana rune_of_power, brons_call_to_action(15)
2:11.446 aoe q arcane_explosion Fluffy_Pillow 21571.9/63371: 34% mana arcane_charge, rune_of_power, brons_call_to_action(16)
2:12.751 aoe q arcane_explosion Fluffy_Pillow 18225.9/63371: 29% mana arcane_charge(2), rune_of_power, brons_call_to_action(17)
2:14.058 aoe q arcane_explosion Fluffy_Pillow 14882.5/63371: 23% mana arcane_charge(3), rune_of_power, brons_call_to_action(18)
2:15.363 aoe l radiant_spark Fluffy_Pillow 11536.5/63371: 18% mana arcane_charge(4), brons_call_to_action(19)
2:16.669 aoe n arcane_power Fluffy_Pillow 12191.7/63371: 19% mana arcane_charge(4), brons_call_to_action(20)
2:16.669 aoe r arcane_barrage Fluffy_Pillow 12191.7/63371: 19% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(20)
2:17.975 aoe q arcane_explosion Fluffy_Pillow 16381.8/63371: 26% mana arcane_power, rune_of_power, brons_call_to_action(20)
2:19.281 aoe q arcane_explosion Fluffy_Pillow 15537.1/63371: 25% mana arcane_charge, arcane_power, rune_of_power, brons_call_to_action(21)
2:20.588 aoe q arcane_explosion Fluffy_Pillow 14693.6/63371: 23% mana arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(22)
2:21.895 aoe q arcane_explosion Fluffy_Pillow 13850.2/63371: 22% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(23)
2:23.201 shared_cds t use_mana_gem Kyrian_Forgelite 13005.4/63371: 21% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(24)
2:23.201 aoe r arcane_barrage Fluffy_Pillow 19342.6/63371: 31% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(24)
2:24.507 aoe p arcane_orb Fluffy_Pillow 23532.7/63371: 37% mana arcane_power, rune_of_power, brons_call_to_action(25)
2:25.814 aoe r arcane_barrage Fluffy_Pillow 24939.2/63371: 39% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(26)
2:27.119 aoe q arcane_explosion Fluffy_Pillow 29128.1/63371: 46% mana arcane_power, rune_of_power, brons_call_to_action(27)
2:28.426 aoe q arcane_explosion Fluffy_Pillow 28284.6/63371: 45% mana arcane_charge, arcane_power, clearcasting, rune_of_power, brons_call_to_action(28)
2:29.734 aoe q arcane_explosion Fluffy_Pillow 29942.4/63371: 47% mana arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(29)
2:31.039 aoe q arcane_explosion Fluffy_Pillow 29096.4/63371: 46% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(30)
2:32.345 aoe r arcane_barrage Fluffy_Pillow 28251.6/63371: 45% mana arcane_charge(4), brons_call_to_action(31)
2:33.653 aoe q arcane_explosion Fluffy_Pillow 32444.3/63371: 51% mana brons_call_to_action(32)
2:34.960 aoe q arcane_explosion Fluffy_Pillow 29100.8/63371: 46% mana arcane_charge, brons_call_to_action(33)
2:36.267 aoe q arcane_explosion Fluffy_Pillow 25757.4/63371: 41% mana arcane_charge(2), brons_call_to_action(34)
2:37.573 aoe q arcane_explosion Fluffy_Pillow 22412.6/63371: 35% mana arcane_charge(3), brons_call_to_action(35)
2:38.880 aoe r arcane_barrage Fluffy_Pillow 19069.1/63371: 30% mana arcane_charge(4), brons_call_to_action(36)
2:40.186 aoe q arcane_explosion Fluffy_Pillow 23259.3/63371: 37% mana brons_call_to_action(37)
2:41.493 aoe q arcane_explosion Fluffy_Pillow 19915.8/63371: 31% mana arcane_charge, brons_call_to_action(38)
2:42.799 aoe q arcane_explosion Fluffy_Pillow 16571.1/63371: 26% mana arcane_charge(2), brons_call_to_action(39)
2:44.104 aoe q arcane_explosion Fluffy_Pillow 13225.1/63371: 21% mana arcane_charge(3), brons_call_to_action(40)
2:45.411 aoe r arcane_barrage Fluffy_Pillow 9881.6/63371: 16% mana arcane_charge(4), brons_call_to_action(41)
2:46.716 aoe k radiant_spark Fluffy_Pillow 14070.4/63371: 22% mana brons_call_to_action(42)
2:48.023 aoe m touch_of_the_magi Fluffy_Pillow 14727.0/63371: 23% mana brons_call_to_action(43)
2:49.331 aoe o rune_of_power Fluffy_Pillow 13884.8/63371: 22% mana arcane_charge(4), brons_call_to_action(44)
2:50.637 aoe r arcane_barrage Fluffy_Pillow 15540.0/63371: 25% mana arcane_charge(4), rune_of_power, brons_call_to_action(45)
2:51.943 aoe p arcane_orb Fluffy_Pillow 19730.1/63371: 31% mana rune_of_power, brons_call_to_action(45)
2:53.249 aoe r arcane_barrage Fluffy_Pillow 20885.4/63371: 33% mana arcane_charge(4), rune_of_power, brons_call_to_action(46)
2:54.554 aoe q arcane_explosion Fluffy_Pillow 25074.3/63371: 40% mana rune_of_power, brons_call_to_action(47)
2:55.861 aoe q arcane_explosion Fluffy_Pillow 21730.8/63371: 34% mana arcane_charge, rune_of_power, brons_call_to_action(48)
2:57.168 aoe q arcane_explosion Fluffy_Pillow 18387.3/63371: 29% mana arcane_charge(2), rune_of_power, brons_call_to_action(49)
2:58.473 aoe q arcane_explosion Fluffy_Pillow 15041.3/63371: 24% mana arcane_charge(3), rune_of_power, brons_call_to_action(50)
2:59.780 aoe r arcane_barrage Fluffy_Pillow 11697.8/63371: 18% mana arcane_charge(4), rune_of_power, brons_call_to_action(51)
3:01.084 aoe q arcane_explosion Fluffy_Pillow 15885.4/63371: 25% mana rune_of_power, brons_call_to_action(52)
3:02.389 aoe q arcane_explosion Fluffy_Pillow 12539.4/63371: 20% mana arcane_charge, rune_of_power, brons_call_to_action(53)
3:03.696 aoe q arcane_explosion Fluffy_Pillow 9195.9/63371: 15% mana arcane_charge(2), rune_of_power, brons_call_to_action(54)
3:05.003 aoe q arcane_explosion Fluffy_Pillow 5852.5/63371: 9% mana arcane_charge(3), clearcasting, rune_of_power, brons_call_to_action(55)
3:06.309 aoe r arcane_barrage Fluffy_Pillow 7507.7/63371: 12% mana arcane_charge(4), brons_call_to_action(56)
3:07.616 aoe q arcane_explosion Fluffy_Pillow 11699.1/63371: 18% mana brons_call_to_action(57)
3:08.921 aoe q arcane_explosion Fluffy_Pillow 8353.1/63371: 13% mana arcane_charge, brons_call_to_action(58)
3:10.228 aoe q arcane_explosion Fluffy_Pillow 5009.6/63371: 8% mana arcane_charge(2), brons_call_to_action(59)
3:11.535 aoe q arcane_explosion Fluffy_Pillow 1666.2/63371: 3% mana arcane_charge(3), clearcasting, brons_call_to_action(60)
3:12.843 aoe r arcane_barrage Fluffy_Pillow 3324.0/63371: 5% mana arcane_charge(4), brons_call_to_action(61)
3:14.149 aoe p arcane_orb Fluffy_Pillow 7514.1/63371: 12% mana brons_call_to_action(62)
3:15.454 aoe r arcane_barrage Fluffy_Pillow 8668.1/63371: 14% mana arcane_charge(4), brons_call_to_action(63)
3:16.760 aoe q arcane_explosion Fluffy_Pillow 12858.2/63371: 20% mana brons_call_to_action(64)
3:18.067 aoe j radiant_spark Fluffy_Pillow 9514.7/63371: 15% mana arcane_charge, brons_call_to_action(65)
3:19.373 aoe q arcane_explosion Fluffy_Pillow 10170.0/63371: 16% mana arcane_charge, brons_call_to_action(66)
3:20.679 aoe q arcane_explosion Fluffy_Pillow 6825.3/63371: 11% mana arcane_charge(2), brons_call_to_action(66)
3:21.985 aoe s evocation Kyrian_Forgelite 3480.5/63371: 5% mana arcane_charge(3), brons_call_to_action(67)
3:26.329 aoe q arcane_explosion Fluffy_Pillow 57325.2/63371: 90% mana arcane_charge(3), brons_call_to_action(67)
3:27.637 aoe r arcane_barrage Fluffy_Pillow 53983.0/63371: 85% mana arcane_charge(4), brons_call_to_action(68)
3:28.945 aoe q arcane_explosion Fluffy_Pillow 58175.6/63371: 92% mana brons_call_to_action(69)
3:30.252 aoe q arcane_explosion Fluffy_Pillow 54832.2/63371: 87% mana arcane_charge, brons_call_to_action(70)
3:31.559 aoe q arcane_explosion Fluffy_Pillow 51488.7/63371: 81% mana arcane_charge(2), brons_call_to_action(71)
3:32.865 aoe q arcane_explosion Fluffy_Pillow 48144.0/63371: 76% mana arcane_charge(3), brons_call_to_action(72)
3:34.171 aoe r arcane_barrage Fluffy_Pillow 44799.2/63371: 71% mana arcane_charge(4), brons_call_to_action(73)
3:35.478 aoe m touch_of_the_magi Fluffy_Pillow 48990.6/63371: 77% mana brons_call_to_action(74)
3:36.784 aoe o rune_of_power Fluffy_Pillow 48145.9/63371: 76% mana arcane_charge(4), brons_call_to_action(75)
3:38.089 aoe r arcane_barrage Fluffy_Pillow 49799.9/63371: 79% mana arcane_charge(4), rune_of_power, brons_call_to_action(76)
3:39.396 aoe p arcane_orb Fluffy_Pillow 53991.2/63371: 85% mana rune_of_power, brons_call_to_action(76)
3:40.702 aoe r arcane_barrage Fluffy_Pillow 55146.5/63371: 87% mana arcane_charge(4), rune_of_power, brons_call_to_action(77)
3:42.009 aoe q arcane_explosion Fluffy_Pillow 59337.9/63371: 94% mana rune_of_power, brons_call_to_action(78)
3:43.316 aoe q arcane_explosion Fluffy_Pillow 55994.4/63371: 88% mana arcane_charge, rune_of_power, brons_call_to_action(79)
3:44.623 aoe q arcane_explosion Fluffy_Pillow 52650.9/63371: 83% mana arcane_charge(2), rune_of_power, brons_call_to_action(80)
3:45.930 aoe q arcane_explosion Fluffy_Pillow 49307.5/63371: 78% mana arcane_charge(3), rune_of_power, brons_call_to_action(81)
3:47.237 aoe r arcane_barrage Fluffy_Pillow 45964.0/63371: 73% mana arcane_charge(4), rune_of_power, brons_call_to_action(82)
3:48.545 aoe q arcane_explosion Fluffy_Pillow 50156.7/63371: 79% mana rune_of_power, brons_call_to_action(83)
3:49.852 aoe j radiant_spark Fluffy_Pillow 46813.2/63371: 74% mana arcane_charge, rune_of_power, brons_call_to_action(84)
3:51.157 aoe q arcane_explosion Fluffy_Pillow 47467.2/63371: 75% mana arcane_charge, rune_of_power, brons_call_to_action(85)
3:52.464 aoe q arcane_explosion Fluffy_Pillow 44123.7/63371: 70% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(85)
3:53.771 aoe q arcane_explosion Fluffy_Pillow 45780.2/63371: 72% mana arcane_charge(3), brons_call_to_action(86)
3:55.078 aoe r arcane_barrage Fluffy_Pillow 42436.8/63371: 67% mana arcane_charge(4), clearcasting, brons_call_to_action(87)
3:56.384 aoe q arcane_explosion Fluffy_Pillow 46626.9/63371: 74% mana clearcasting, brons_call_to_action(88)
3:57.690 aoe q arcane_explosion Fluffy_Pillow 48282.2/63371: 76% mana arcane_charge, brons_call_to_action(89)
3:58.997 aoe q arcane_explosion Fluffy_Pillow 44938.7/63371: 71% mana arcane_charge(2)
4:00.303 aoe q arcane_explosion Fluffy_Pillow 41593.9/63371: 66% mana arcane_charge(3), brons_call_to_action
4:01.610 aoe r arcane_barrage Fluffy_Pillow 38250.5/63371: 60% mana arcane_charge(4), clearcasting, brons_call_to_action(2)
4:02.917 aoe p arcane_orb Fluffy_Pillow 42441.9/63371: 67% mana clearcasting, brons_call_to_action(3)
4:04.224 aoe r arcane_barrage Fluffy_Pillow 43598.4/63371: 69% mana arcane_charge(4), clearcasting, brons_call_to_action(4)
4:05.529 aoe q arcane_explosion Fluffy_Pillow 47787.2/63371: 75% mana clearcasting, brons_call_to_action(5)
4:06.836 aoe q arcane_explosion Fluffy_Pillow 49443.8/63371: 78% mana arcane_charge, brons_call_to_action(6)
4:08.144 aoe q arcane_explosion Fluffy_Pillow 46101.6/63371: 73% mana arcane_charge(2), brons_call_to_action(7)
4:09.451 aoe q arcane_explosion Fluffy_Pillow 42758.1/63371: 67% mana arcane_charge(3), brons_call_to_action(8)
4:10.757 aoe r arcane_barrage Fluffy_Pillow 39413.4/63371: 62% mana arcane_charge(4), clearcasting, brons_call_to_action(9)
4:12.064 aoe q arcane_explosion Fluffy_Pillow 43604.7/63371: 69% mana clearcasting, brons_call_to_action(10)
4:13.371 aoe q arcane_explosion Fluffy_Pillow 45261.3/63371: 71% mana arcane_charge, brons_call_to_action(11)
4:14.677 aoe q arcane_explosion Fluffy_Pillow 41916.5/63371: 66% mana arcane_charge(2), brons_call_to_action(12)
4:15.983 aoe q arcane_explosion Fluffy_Pillow 38571.8/63371: 61% mana arcane_charge(3), brons_call_to_action(13)
4:17.290 aoe r arcane_barrage Fluffy_Pillow 35228.3/63371: 56% mana arcane_charge(4), clearcasting, brons_call_to_action(14)
4:18.598 aoe q arcane_explosion Fluffy_Pillow 39421.0/63371: 62% mana clearcasting, brons_call_to_action(15)
4:19.904 aoe q arcane_explosion Fluffy_Pillow 41076.2/63371: 65% mana arcane_charge, brons_call_to_action(16)
4:21.211 aoe q arcane_explosion Fluffy_Pillow 37732.8/63371: 60% mana arcane_charge(2), brons_call_to_action(17)
4:22.517 aoe q arcane_explosion Fluffy_Pillow 34388.0/63371: 54% mana arcane_charge(3), brons_call_to_action(18)
4:23.822 shared_cds t use_mana_gem Kyrian_Forgelite 31042.0/63371: 49% mana arcane_charge(4), clearcasting, brons_call_to_action(19)
4:23.822 aoe r arcane_barrage Fluffy_Pillow 37379.2/63371: 59% mana arcane_charge(4), clearcasting, brons_call_to_action(19)
4:25.129 aoe k radiant_spark Fluffy_Pillow 41570.6/63371: 66% mana clearcasting, brons_call_to_action(20)
4:26.435 aoe m touch_of_the_magi Fluffy_Pillow 42225.8/63371: 67% mana clearcasting, brons_call_to_action(21)
4:27.741 aoe n arcane_power Fluffy_Pillow 41381.1/63371: 65% mana arcane_charge(4), clearcasting, brons_call_to_action(22)
4:27.741 shared_cds v berserking Fluffy_Pillow 41381.1/63371: 65% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(22)
4:27.741 aoe r arcane_barrage Fluffy_Pillow 41381.1/63371: 65% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(22)
4:28.930 aoe p arcane_orb Fluffy_Pillow 45422.9/63371: 72% mana berserking, arcane_power, clearcasting, rune_of_power, brons_call_to_action(22)
4:30.117 aoe r arcane_barrage Fluffy_Pillow 46677.3/63371: 74% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(23)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Forgelite"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=333950//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Kyrian_Pelagos : 17058 dps, 4950 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17058.3 17058.3 26.4 / 0.155% 1684.3 / 9.9% 8.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
1995.2 1905.9 Mana 0.00% 49.5 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 17058
Arcane Barrage 5737 33.7% 55.2 5.42sec 31116 24969 Direct 275.6 5226 10476 6235 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.20 275.63 0.00 0.00 1.2462 0.0000 1717755.28 1717755.28 0.00% 24968.82 24968.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 222.67 170 287 5226.10 2082 31635 5212.70 4640 5688 1163252 1163252 0.00%
crit 19.21% 52.96 23 88 10475.96 4164 63270 10444.12 7279 14135 554504 554504 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.21
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 624 3.7% 59.2 4.72sec 3146 0 Direct 296.1 528 1056 629 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.21 296.07 0.00 0.00 0.0000 0.0000 186283.59 186283.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 239.02 177 313 527.53 316 664 526.85 485 568 126052 126052 0.00%
crit 19.27% 57.05 32 85 1056.20 633 1329 1054.82 927 1169 60232 60232 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7768 45.5% 148.4 1.98sec 15642 12590 Direct 741.8 2620 5249 3129 19.4%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.36 741.79 0.00 0.00 1.2424 0.0000 2320637.71 2320637.71 0.00% 12590.47 12590.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 598.14 464 740 2620.07 1958 6227 2619.88 2524 2713 1566897 1566897 0.00%
crit 19.37% 143.65 99 201 5248.57 3916 12454 5247.77 4841 5737 753741 753741 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:148.36
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1427) 0.0% (8.4%) 12.7 24.16sec 33505 26900

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.73 0.00 0.00 0.00 1.2456 0.0000 0.00 0.00 0.00% 26900.21 26900.21

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.74
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1427 8.4% 63.6 24.15sec 6710 0 Direct 63.6 5630 11269 6713 19.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.57 63.57 0.00 0.00 0.0000 0.0000 426583.48 426583.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 51.36 35 69 5629.72 3869 9669 5626.27 5133 6155 289081 289081 0.00%
crit 19.21% 12.21 3 25 11269.11 7739 19338 11261.51 7739 15667 137502 137502 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.74sec 1390 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.68 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.74sec 1390 0 Direct 14.7 1164 2327 1389 19.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.68 14.68 0.00 0.00 0.0000 0.0000 20396.09 20396.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 11.82 5 20 1163.53 1164 1164 1163.53 1164 1164 13755 13755 0.00%
crit 19.44% 2.85 0 8 2327.06 2327 2327 2231.05 0 2327 6641 6641 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1787 20.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1786.12 1786.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.37% 0.79 0 1 1480.68 1481 1481 1175.23 0 1481 1175 1175 0.00%
crit 20.63% 0.21 0 1 2961.35 2961 2961 610.89 0 2961 611 611 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.1%) 1.0 0.00sec 6091 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 21 0.1% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6091.34 6091.34 0.00% 51.72 51.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 72.77 60 83 56.79 43 60 56.79 56 59 4132 4132 0.00%
crit 19.15% 17.23 7 30 113.67 86 120 113.63 102 120 1959 1959 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 189 1.1% 9.3 33.91sec 6086 4779 Direct 9.3 3020 6091 3602 19.0%
Periodic 60.3 320 643 382 19.2% 6.1%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.27 9.27 60.31 60.31 1.2736 1.5122 56444.50 56444.50 0.00% 547.99 4778.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.01% 7.51 3 11 3020.40 2693 5655 3020.34 2693 3703 22694 22694 0.00%
crit 18.99% 1.76 0 6 6091.17 5386 11310 5320.72 0 11310 10729 10729 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 48.73 33 67 319.79 34 501 319.30 283 356 15580 15580 0.00%
crit 19.19% 11.57 2 25 643.43 68 1003 641.83 375 871 7441 7441 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.52
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.80
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.99
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (1217) 0.0% (7.1%) 5.9 54.65sec 61416 48914

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.91 0.00 0.00 0.00 1.2558 0.0000 0.00 0.00 0.00% 48914.07 48914.07

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.93
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1217 7.1% 5.9 54.52sec 61416 0 Direct 29.5 12325 0 12325 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.91 29.49 0.00 0.00 0.0000 0.0000 363186.99 363186.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 29.49 20 35 12325.43 85 58005 12314.98 9874 15499 363187 363187 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:23088.01
  • base_dd_max:23088.01
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Kyrian_Pelagos
Arcane Power 2.8 131.84sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.78
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 263.13sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.78
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.9 170.58sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.94 0.00 5.60 0.00 4.3162 0.7224 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:0.94
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.7 52.78sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.74 0.00 0.00 0.00 1.2542 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.77
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.34sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.9 174.7 5.3sec 1.3sec 3.9sec 72.15% 0.00% 25.6 (25.7) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.80%
  • arcane_charge_2:16.04%
  • arcane_charge_3:15.93%
  • arcane_charge_4:21.37%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 132.1sec 132.1sec 14.6sec 13.53% 0.00% 0.0 (0.0) 2.6

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.53%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 263.8sec 263.8sec 11.6sec 6.82% 23.11% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.0s / 272.0s
  • trigger_min/max:241.0s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:6.82%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 23.8 0.2 12.1sec 12.0sec 2.1sec 16.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.22%
  • clearcasting_2:0.24%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Combat Meditation 4.9 0.0 67.6sec 67.6sec 7.9sec 12.87% 0.00% 9.6 (9.6) 4.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:0.50
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:62.7s / 88.0s
  • trigger_min/max:62.7s / 88.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • combat_meditation_1:12.87%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 0.9 0.0 177.1sec 177.1sec 4.3sec 1.36% 0.00% 3.7 (3.7) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:119.3s / 243.5s
  • trigger_min/max:119.3s / 243.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:1.36%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.48%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.5 0.0 36.6sec 36.6sec 14.6sec 41.67% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 55.3s
  • trigger_min/max:16.8s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:41.67%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.44% 0.84% 7.02% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.911120.053239.917
Evocation177.46629.313336.591231.674142.452351.426
Rune of Power8.4711.13729.92051.09531.84477.482
Touch of the Magi6.9571.13529.91843.47730.53876.175
Arcane Power8.5460.37218.92424.2442.69834.271
Arcane Barrage2.9190.0029.585162.298129.323196.790
Arcane Orb4.0950.01911.79352.61240.12369.221
Radiant Spark2.2610.00025.18521.6709.69458.570

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
mana_regen Mana 623.20 371362.81 65.19% 595.89 11516.79 3.01%
Evocation Mana 44.78 45134.86 7.92% 1007.91 0.00 0.00%
Mana Gem Mana 2.74 17776.52 3.12% 6488.15 0.00 0.00%
Arcane Barrage Mana 55.21 135420.57 23.77% 2453.00 6798.74 4.78%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1905.89 1995.24 18322.5 35606.5 9.8 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
arcane_explosion Mana 148.4 565689.1 3813.0 3813.0 4.1
arcane_orb Mana 12.7 5691.2 446.9 447.0 75.0
radiant_spark Mana 9.3 9177.0 988.8 989.5 6.2
touch_of_the_magi Mana 5.9 14787.2 2500.0 2500.6 24.6

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Kyrian_Pelagos Damage Per Second
Count 1018
Mean 17058.35
Minimum 15762.47
Maximum 18446.65
Spread ( max - min ) 2684.17
Range [ ( max - min ) / 2 * 100% ] 7.87%
Standard Deviation 429.9274
5th Percentile 16373.32
95th Percentile 17765.78
( 95th Percentile - 5th Percentile ) 1392.47
Mean Distribution
Standard Deviation 13.4748
95.00% Confidence Interval ( 17031.94 - 17084.76 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2441
0.1 Scale Factor Error with Delta=300 1578
0.05 Scale Factor Error with Delta=300 6312
0.01 Scale Factor Error with Delta=300 157788
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 1018
Mean 4950.48
Minimum 4335.21
Maximum 5548.15
Spread ( max - min ) 1212.94
Range [ ( max - min ) / 2 * 100% ] 12.25%
Standard Deviation 189.3158
5th Percentile 4653.78
95th Percentile 5282.45
( 95th Percentile - 5th Percentile ) 628.68
Mean Distribution
Standard Deviation 5.9335
95.00% Confidence Interval ( 4938.85 - 4962.11 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5618
0.1 Scale Factor Error with Delta=300 306
0.05 Scale Factor Error with Delta=300 1224
0.01 Scale Factor Error with Delta=300 30596
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 1018
Mean 17058.35
Minimum 15762.47
Maximum 18446.65
Spread ( max - min ) 2684.17
Range [ ( max - min ) / 2 * 100% ] 7.87%
Damage
Kyrian_Pelagos Damage
Count 1018
Mean 5093073.76
Minimum 3927307.74
Maximum 6196349.25
Spread ( max - min ) 2269041.51
Range [ ( max - min ) / 2 * 100% ] 22.28%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.52 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.80 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.99 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.93 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.78 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.77 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.74 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 148.36 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.21 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 0.94 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.78 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqtqrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqtrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrjqqqqrqqqsqrprqqqqrqqqqtrkmnvrqq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe m touch_of_the_magi Fluffy_Pillow 68283.7/69371: 98% mana bloodlust, combat_meditation
0:02.311 aoe n arcane_power Fluffy_Pillow 66874.2/69371: 96% mana bloodlust, arcane_charge(4), combat_meditation
0:02.311 shared_cds u potion Fluffy_Pillow 66874.2/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
0:02.311 shared_cds v berserking Fluffy_Pillow 66874.2/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:02.311 aoe r arcane_barrage Fluffy_Pillow 66874.2/69371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:03.224 aoe p arcane_orb Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:04.138 aoe r arcane_barrage Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.052 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.965 aoe q arcane_explosion Fluffy_Pillow 68138.2/69371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:06.879 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:07.796 aoe q arcane_explosion Fluffy_Pillow 68143.7/69371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:08.708 aoe r arcane_barrage Fluffy_Pillow 66909.0/69371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:09.622 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.536 aoe q arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.450 aoe q arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.366 aoe q arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.281 aoe r arcane_barrage Fluffy_Pillow 58008.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.196 aoe q arcane_explosion Fluffy_Pillow 61703.5/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.112 aoe q arcane_explosion Fluffy_Pillow 60364.5/63371: 95% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.118 aoe q arcane_explosion Fluffy_Pillow 59139.5/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.123 aoe q arcane_explosion Fluffy_Pillow 57913.3/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:18.129 aoe o rune_of_power Fluffy_Pillow 59188.3/63371: 93% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.136 aoe r arcane_barrage Fluffy_Pillow 60464.6/63371: 95% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.144 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.149 aoe q arcane_explosion Fluffy_Pillow 59645.2/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.155 aoe q arcane_explosion Fluffy_Pillow 55920.2/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.163 shared_cds t use_mana_gem Kyrian_Pelagos 52197.8/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.163 aoe q arcane_explosion Fluffy_Pillow 58534.9/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.169 aoe r arcane_barrage Fluffy_Pillow 54810.0/63371: 86% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:25.176 aoe p arcane_orb Fluffy_Pillow 58621.1/63371: 93% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.183 aoe r arcane_barrage Fluffy_Pillow 59397.4/63371: 94% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.190 aoe q arcane_explosion Fluffy_Pillow 63208.6/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:28.195 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power
0:29.201 aoe q arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power
0:30.210 aoe q arcane_explosion Fluffy_Pillow 55925.3/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power
0:31.215 aoe r arcane_barrage Fluffy_Pillow 52199.1/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power
0:32.221 aoe j radiant_spark Fluffy_Pillow 56009.0/63371: 88% mana bloodlust, rune_of_power
0:33.227 aoe q arcane_explosion Fluffy_Pillow 56284.0/63371: 89% mana bloodlust, clearcasting, rune_of_power
0:34.232 aoe q arcane_explosion Fluffy_Pillow 57557.8/63371: 91% mana bloodlust, arcane_charge
0:35.238 aoe q arcane_explosion Fluffy_Pillow 53832.8/63371: 85% mana bloodlust, arcane_charge(2), clearcasting
0:36.244 aoe q arcane_explosion Fluffy_Pillow 55107.8/63371: 87% mana bloodlust, arcane_charge(3)
0:37.252 aoe r arcane_barrage Fluffy_Pillow 51385.4/63371: 81% mana bloodlust, arcane_charge(4)
0:38.258 aoe q arcane_explosion Fluffy_Pillow 55195.3/63371: 87% mana bloodlust
0:39.265 aoe q arcane_explosion Fluffy_Pillow 51471.6/63371: 81% mana bloodlust, arcane_charge
0:40.272 aoe q arcane_explosion Fluffy_Pillow 47747.9/63371: 75% mana bloodlust, arcane_charge(2)
0:41.280 aoe q arcane_explosion Fluffy_Pillow 44025.4/63371: 69% mana arcane_charge(3)
0:42.587 aoe r arcane_barrage Fluffy_Pillow 40682.0/63371: 64% mana arcane_charge(4)
0:43.892 aoe q arcane_explosion Fluffy_Pillow 44870.8/63371: 71% mana
0:45.197 aoe q arcane_explosion Fluffy_Pillow 41524.8/63371: 66% mana arcane_charge
0:46.502 aoe q arcane_explosion Fluffy_Pillow 38178.8/63371: 60% mana arcane_charge(2)
0:47.810 aoe q arcane_explosion Fluffy_Pillow 34836.6/63371: 55% mana arcane_charge(3), clearcasting
0:49.118 aoe r arcane_barrage Fluffy_Pillow 36494.4/63371: 58% mana arcane_charge(4)
0:50.423 aoe p arcane_orb Fluffy_Pillow 40683.3/63371: 64% mana
0:51.731 aoe r arcane_barrage Fluffy_Pillow 41841.1/63371: 66% mana arcane_charge(4)
0:53.038 aoe q arcane_explosion Fluffy_Pillow 46032.4/63371: 73% mana
0:54.345 aoe q arcane_explosion Fluffy_Pillow 42689.0/63371: 67% mana arcane_charge
0:55.651 aoe q arcane_explosion Fluffy_Pillow 39344.2/63371: 62% mana arcane_charge(2)
0:56.957 aoe q arcane_explosion Fluffy_Pillow 35999.5/63371: 57% mana arcane_charge(3), clearcasting
0:58.264 aoe r arcane_barrage Fluffy_Pillow 37656.0/63371: 59% mana arcane_charge(4)
0:59.570 aoe q arcane_explosion Fluffy_Pillow 41846.1/63371: 66% mana
1:00.876 aoe q arcane_explosion Fluffy_Pillow 38501.4/63371: 61% mana arcane_charge, clearcasting
1:02.184 aoe q arcane_explosion Fluffy_Pillow 40159.2/63371: 63% mana arcane_charge(2)
1:03.492 aoe q arcane_explosion Fluffy_Pillow 36817.0/63371: 58% mana arcane_charge(3)
1:04.800 aoe r arcane_barrage Fluffy_Pillow 33474.8/63371: 53% mana arcane_charge(4)
1:06.107 aoe k radiant_spark Fluffy_Pillow 37666.2/63371: 59% mana
1:07.415 aoe m touch_of_the_magi Fluffy_Pillow 41952.5/69371: 60% mana combat_meditation
1:08.722 aoe o rune_of_power Fluffy_Pillow 41265.9/69371: 59% mana arcane_charge(4), combat_meditation
1:10.029 aoe r arcane_barrage Fluffy_Pillow 43079.2/69371: 62% mana arcane_charge(4), rune_of_power, combat_meditation
1:11.336 aoe p arcane_orb Fluffy_Pillow 47667.5/69371: 69% mana rune_of_power, combat_meditation
1:12.644 aoe r arcane_barrage Fluffy_Pillow 48982.2/69371: 71% mana arcane_charge(4), rune_of_power, combat_meditation
1:13.951 aoe q arcane_explosion Fluffy_Pillow 53570.4/69371: 77% mana rune_of_power, combat_meditation
1:15.259 aoe q arcane_explosion Fluffy_Pillow 50385.2/69371: 73% mana arcane_charge, rune_of_power, combat_meditation
1:16.566 aoe q arcane_explosion Fluffy_Pillow 43116.3/63371: 68% mana arcane_charge(2), clearcasting, rune_of_power
1:17.872 aoe q arcane_explosion Fluffy_Pillow 44771.6/63371: 71% mana arcane_charge(3), rune_of_power
1:19.179 aoe r arcane_barrage Fluffy_Pillow 41428.1/63371: 65% mana arcane_charge(4), rune_of_power
1:20.487 aoe q arcane_explosion Fluffy_Pillow 45620.8/63371: 72% mana rune_of_power
1:21.794 aoe q arcane_explosion Fluffy_Pillow 42277.3/63371: 67% mana arcane_charge, rune_of_power
1:23.100 aoe q arcane_explosion Fluffy_Pillow 38932.5/63371: 61% mana arcane_charge(2), rune_of_power
1:24.407 aoe q arcane_explosion Fluffy_Pillow 35589.1/63371: 56% mana arcane_charge(3), rune_of_power
1:25.713 aoe r arcane_barrage Fluffy_Pillow 32244.3/63371: 51% mana arcane_charge(4), clearcasting
1:27.017 aoe q arcane_explosion Fluffy_Pillow 36431.9/63371: 57% mana clearcasting
1:28.323 aoe q arcane_explosion Fluffy_Pillow 38087.2/63371: 60% mana arcane_charge
1:29.630 aoe q arcane_explosion Fluffy_Pillow 34743.7/63371: 55% mana arcane_charge(2), clearcasting
1:30.936 aoe q arcane_explosion Fluffy_Pillow 36399.0/63371: 57% mana arcane_charge(3)
1:32.245 aoe r arcane_barrage Fluffy_Pillow 33058.0/63371: 52% mana arcane_charge(4)
1:33.550 aoe p arcane_orb Fluffy_Pillow 37246.9/63371: 59% mana
1:34.856 aoe r arcane_barrage Fluffy_Pillow 38402.2/63371: 61% mana arcane_charge(4)
1:36.161 aoe q arcane_explosion Fluffy_Pillow 42591.0/63371: 67% mana
1:37.467 aoe j radiant_spark Fluffy_Pillow 39246.3/63371: 62% mana arcane_charge
1:38.773 aoe q arcane_explosion Fluffy_Pillow 39901.5/63371: 63% mana arcane_charge
1:40.080 aoe q arcane_explosion Fluffy_Pillow 36558.1/63371: 58% mana arcane_charge(2), clearcasting
1:41.386 aoe q arcane_explosion Fluffy_Pillow 38213.3/63371: 60% mana arcane_charge(3)
1:42.694 aoe r arcane_barrage Fluffy_Pillow 34871.1/63371: 55% mana arcane_charge(4), clearcasting
1:44.001 aoe q arcane_explosion Fluffy_Pillow 39062.5/63371: 62% mana clearcasting
1:45.307 aoe q arcane_explosion Fluffy_Pillow 40717.8/63371: 64% mana arcane_charge
1:46.613 aoe q arcane_explosion Fluffy_Pillow 37373.0/63371: 59% mana arcane_charge(2)
1:47.920 aoe q arcane_explosion Fluffy_Pillow 34029.6/63371: 54% mana arcane_charge(3)
1:49.227 aoe r arcane_barrage Fluffy_Pillow 30686.1/63371: 48% mana arcane_charge(4)
1:50.533 aoe q arcane_explosion Fluffy_Pillow 34876.2/63371: 55% mana
1:51.841 aoe q arcane_explosion Fluffy_Pillow 31534.0/63371: 50% mana arcane_charge
1:53.147 aoe q arcane_explosion Fluffy_Pillow 28189.3/63371: 44% mana arcane_charge(2)
1:54.452 aoe q arcane_explosion Fluffy_Pillow 24843.3/63371: 39% mana arcane_charge(3), clearcasting
1:55.759 aoe r arcane_barrage Fluffy_Pillow 26499.8/63371: 42% mana arcane_charge(4)
1:57.065 aoe m touch_of_the_magi Fluffy_Pillow 30689.9/63371: 48% mana
1:58.372 aoe o rune_of_power Fluffy_Pillow 29846.4/63371: 47% mana arcane_charge(4)
1:59.678 aoe r arcane_barrage Fluffy_Pillow 31501.7/63371: 50% mana arcane_charge(4), rune_of_power
2:00.986 aoe p arcane_orb Fluffy_Pillow 35694.3/63371: 56% mana rune_of_power
2:02.294 aoe r arcane_barrage Fluffy_Pillow 36852.1/63371: 58% mana arcane_charge(4), rune_of_power
2:03.600 aoe q arcane_explosion Fluffy_Pillow 41042.3/63371: 65% mana rune_of_power
2:04.908 aoe q arcane_explosion Fluffy_Pillow 37700.1/63371: 59% mana arcane_charge, rune_of_power
2:06.215 aoe q arcane_explosion Fluffy_Pillow 34356.6/63371: 54% mana arcane_charge(2), rune_of_power
2:07.522 aoe q arcane_explosion Fluffy_Pillow 31013.1/63371: 49% mana arcane_charge(3), rune_of_power
2:08.828 aoe r arcane_barrage Fluffy_Pillow 27668.4/63371: 44% mana arcane_charge(4), rune_of_power
2:10.136 aoe q arcane_explosion Fluffy_Pillow 31861.0/63371: 50% mana rune_of_power
2:11.443 aoe q arcane_explosion Fluffy_Pillow 28517.6/63371: 45% mana arcane_charge, rune_of_power
2:12.749 aoe q arcane_explosion Fluffy_Pillow 25172.8/63371: 40% mana arcane_charge(2), clearcasting, rune_of_power
2:14.056 aoe q arcane_explosion Fluffy_Pillow 26829.4/63371: 42% mana arcane_charge(3), rune_of_power
2:15.362 aoe l radiant_spark Fluffy_Pillow 23484.6/63371: 37% mana arcane_charge(4)
2:16.669 aoe n arcane_power Fluffy_Pillow 26426.8/69371: 38% mana arcane_charge(4), combat_meditation
2:16.669 aoe r arcane_barrage Fluffy_Pillow 26426.8/69371: 38% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:17.977 aoe q arcane_explosion Fluffy_Pillow 31016.4/69371: 45% mana arcane_power, rune_of_power, combat_meditation
2:19.283 aoe q arcane_explosion Fluffy_Pillow 30328.4/69371: 44% mana arcane_charge, arcane_power, rune_of_power, combat_meditation
2:20.590 aoe q arcane_explosion Fluffy_Pillow 29641.8/69371: 43% mana arcane_charge(2), arcane_power, rune_of_power, combat_meditation
2:21.893 aoe q arcane_explosion Fluffy_Pillow 28949.6/69371: 42% mana arcane_charge(3), arcane_power, rune_of_power, combat_meditation
2:23.200 shared_cds t use_mana_gem Kyrian_Pelagos 28263.0/69371: 41% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:23.200 aoe r arcane_barrage Fluffy_Pillow 35200.1/69371: 51% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:24.507 aoe p arcane_orb Fluffy_Pillow 39788.3/69371: 57% mana arcane_power, rune_of_power, combat_meditation
2:25.814 aoe r arcane_barrage Fluffy_Pillow 37775.2/63371: 60% mana arcane_charge(4), arcane_power, rune_of_power
2:27.120 aoe q arcane_explosion Fluffy_Pillow 41965.3/63371: 66% mana arcane_power, rune_of_power
2:28.428 aoe q arcane_explosion Fluffy_Pillow 41123.1/63371: 65% mana arcane_charge, arcane_power, clearcasting, rune_of_power
2:29.736 aoe q arcane_explosion Fluffy_Pillow 42780.9/63371: 68% mana arcane_charge(2), arcane_power, rune_of_power
2:31.042 aoe q arcane_explosion Fluffy_Pillow 41936.1/63371: 66% mana arcane_charge(3), arcane_power, rune_of_power
2:32.347 aoe r arcane_barrage Fluffy_Pillow 41090.1/63371: 65% mana arcane_charge(4)
2:33.654 aoe q arcane_explosion Fluffy_Pillow 45281.5/63371: 71% mana
2:34.960 aoe q arcane_explosion Fluffy_Pillow 41936.8/63371: 66% mana arcane_charge, clearcasting
2:36.265 aoe q arcane_explosion Fluffy_Pillow 43590.8/63371: 69% mana arcane_charge(2)
2:37.571 aoe q arcane_explosion Fluffy_Pillow 40246.0/63371: 64% mana arcane_charge(3)
2:38.879 aoe r arcane_barrage Fluffy_Pillow 36903.8/63371: 58% mana arcane_charge(4)
2:40.185 aoe q arcane_explosion Fluffy_Pillow 41094.0/63371: 65% mana
2:41.491 aoe q arcane_explosion Fluffy_Pillow 37749.2/63371: 60% mana arcane_charge
2:42.799 aoe q arcane_explosion Fluffy_Pillow 34407.0/63371: 54% mana arcane_charge(2)
2:44.106 aoe q arcane_explosion Fluffy_Pillow 31063.5/63371: 49% mana arcane_charge(3)
2:45.412 aoe r arcane_barrage Fluffy_Pillow 27718.8/63371: 44% mana arcane_charge(4)
2:46.718 aoe k radiant_spark Fluffy_Pillow 31908.9/63371: 50% mana
2:48.026 aoe m touch_of_the_magi Fluffy_Pillow 32566.7/63371: 51% mana
2:49.331 aoe o rune_of_power Fluffy_Pillow 31720.7/63371: 50% mana arcane_charge(4)
2:50.639 aoe r arcane_barrage Fluffy_Pillow 33378.5/63371: 53% mana arcane_charge(4), rune_of_power
2:51.945 aoe p arcane_orb Fluffy_Pillow 37568.6/63371: 59% mana rune_of_power
2:53.251 aoe r arcane_barrage Fluffy_Pillow 38723.9/63371: 61% mana arcane_charge(4), rune_of_power
2:54.559 aoe q arcane_explosion Fluffy_Pillow 42916.5/63371: 68% mana rune_of_power
2:55.866 aoe q arcane_explosion Fluffy_Pillow 39573.1/63371: 62% mana arcane_charge, rune_of_power
2:57.170 aoe q arcane_explosion Fluffy_Pillow 36225.8/63371: 57% mana arcane_charge(2), rune_of_power
2:58.476 aoe q arcane_explosion Fluffy_Pillow 32881.1/63371: 52% mana arcane_charge(3), rune_of_power
2:59.783 aoe r arcane_barrage Fluffy_Pillow 29537.6/63371: 47% mana arcane_charge(4), rune_of_power
3:01.090 aoe q arcane_explosion Fluffy_Pillow 33729.0/63371: 53% mana rune_of_power
3:02.396 aoe q arcane_explosion Fluffy_Pillow 30384.2/63371: 48% mana arcane_charge, rune_of_power
3:03.704 aoe q arcane_explosion Fluffy_Pillow 27042.0/63371: 43% mana arcane_charge(2), clearcasting, rune_of_power
3:05.010 aoe q arcane_explosion Fluffy_Pillow 28697.3/63371: 45% mana arcane_charge(3), rune_of_power
3:06.317 aoe r arcane_barrage Fluffy_Pillow 25353.8/63371: 40% mana arcane_charge(4)
3:07.623 aoe q arcane_explosion Fluffy_Pillow 29543.9/63371: 47% mana
3:08.930 aoe q arcane_explosion Fluffy_Pillow 26200.5/63371: 41% mana arcane_charge
3:10.234 aoe q arcane_explosion Fluffy_Pillow 22853.2/63371: 36% mana arcane_charge(2)
3:11.541 aoe q arcane_explosion Fluffy_Pillow 19509.7/63371: 31% mana arcane_charge(3), clearcasting
3:12.849 aoe r arcane_barrage Fluffy_Pillow 21167.5/63371: 33% mana arcane_charge(4)
3:14.154 aoe p arcane_orb Fluffy_Pillow 25356.4/63371: 40% mana
3:15.460 aoe r arcane_barrage Fluffy_Pillow 26511.6/63371: 42% mana arcane_charge(4)
3:16.767 aoe q arcane_explosion Fluffy_Pillow 30703.0/63371: 48% mana
3:18.074 aoe j radiant_spark Fluffy_Pillow 27359.6/63371: 43% mana arcane_charge
3:19.381 aoe q arcane_explosion Fluffy_Pillow 30668.6/69371: 44% mana arcane_charge, combat_meditation
3:20.686 aoe q arcane_explosion Fluffy_Pillow 27479.2/69371: 40% mana arcane_charge(2), combat_meditation
3:21.993 aoe q arcane_explosion Fluffy_Pillow 24292.6/69371: 35% mana arcane_charge(3), combat_meditation
3:23.298 aoe r arcane_barrage Fluffy_Pillow 21103.2/69371: 30% mana arcane_charge(4), combat_meditation
3:24.604 aoe q arcane_explosion Fluffy_Pillow 25690.0/69371: 37% mana combat_meditation
3:25.910 aoe q arcane_explosion Fluffy_Pillow 22502.0/69371: 32% mana arcane_charge, combat_meditation
3:27.217 aoe q arcane_explosion Fluffy_Pillow 19315.4/69371: 28% mana arcane_charge(2), clearcasting, combat_meditation
3:28.524 aoe q arcane_explosion Fluffy_Pillow 19301.3/63371: 30% mana arcane_charge(3)
3:29.831 aoe r arcane_barrage Fluffy_Pillow 15957.8/63371: 25% mana arcane_charge(4)
3:31.138 aoe q arcane_explosion Fluffy_Pillow 20149.2/63371: 32% mana
3:32.446 aoe q arcane_explosion Fluffy_Pillow 16807.0/63371: 27% mana arcane_charge
3:33.752 aoe q arcane_explosion Fluffy_Pillow 13462.3/63371: 21% mana arcane_charge(2)
3:35.060 aoe q arcane_explosion Fluffy_Pillow 10120.1/63371: 16% mana arcane_charge(3)
3:36.366 aoe r arcane_barrage Fluffy_Pillow 6775.3/63371: 11% mana arcane_charge(4)
3:37.673 aoe m touch_of_the_magi Fluffy_Pillow 10966.7/63371: 17% mana
3:38.981 aoe o rune_of_power Fluffy_Pillow 10124.5/63371: 16% mana arcane_charge(4)
3:40.289 aoe r arcane_barrage Fluffy_Pillow 11782.3/63371: 19% mana arcane_charge(4), rune_of_power
3:41.596 aoe p arcane_orb Fluffy_Pillow 15973.7/63371: 25% mana rune_of_power
3:42.903 aoe r arcane_barrage Fluffy_Pillow 17130.2/63371: 27% mana arcane_charge(4), rune_of_power
3:44.210 aoe q arcane_explosion Fluffy_Pillow 21321.6/63371: 34% mana rune_of_power
3:45.515 aoe q arcane_explosion Fluffy_Pillow 17975.6/63371: 28% mana arcane_charge, rune_of_power
3:46.821 aoe q arcane_explosion Fluffy_Pillow 14630.9/63371: 23% mana arcane_charge(2), rune_of_power
3:48.127 aoe q arcane_explosion Fluffy_Pillow 11286.1/63371: 18% mana arcane_charge(3), rune_of_power
3:49.432 aoe r arcane_barrage Fluffy_Pillow 7940.1/63371: 13% mana arcane_charge(4), rune_of_power
3:50.738 aoe j radiant_spark Fluffy_Pillow 12130.3/63371: 19% mana rune_of_power
3:52.046 aoe q arcane_explosion Fluffy_Pillow 12788.1/63371: 20% mana rune_of_power
3:53.353 aoe q arcane_explosion Fluffy_Pillow 9444.6/63371: 15% mana arcane_charge, rune_of_power
3:54.660 aoe q arcane_explosion Fluffy_Pillow 6101.1/63371: 10% mana arcane_charge(2), rune_of_power
3:55.966 aoe q arcane_explosion Fluffy_Pillow 2756.4/63371: 4% mana arcane_charge(3), clearcasting
3:57.272 aoe r arcane_barrage Fluffy_Pillow 4411.6/63371: 7% mana arcane_charge(4)
3:58.578 aoe q arcane_explosion Fluffy_Pillow 8601.8/63371: 14% mana
3:59.884 aoe q arcane_explosion Fluffy_Pillow 5257.0/63371: 8% mana arcane_charge
4:01.190 aoe q arcane_explosion Fluffy_Pillow 1912.3/63371: 3% mana arcane_charge(2), clearcasting
4:02.496 aoe s evocation Kyrian_Pelagos 3567.5/63371: 6% mana arcane_charge(3)
4:06.841 aoe q arcane_explosion Fluffy_Pillow 57413.5/63371: 91% mana arcane_charge(3)
4:08.147 aoe r arcane_barrage Fluffy_Pillow 54068.7/63371: 85% mana arcane_charge(4)
4:09.452 aoe p arcane_orb Fluffy_Pillow 58257.6/63371: 92% mana
4:10.758 aoe r arcane_barrage Fluffy_Pillow 59412.9/63371: 94% mana arcane_charge(4)
4:12.064 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
4:13.371 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge
4:14.678 aoe q arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), clearcasting
4:15.983 aoe q arcane_explosion Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(3)
4:17.289 aoe r arcane_barrage Fluffy_Pillow 54993.7/63371: 87% mana arcane_charge(4)
4:18.595 aoe q arcane_explosion Fluffy_Pillow 59183.9/63371: 93% mana
4:19.901 aoe q arcane_explosion Fluffy_Pillow 55839.1/63371: 88% mana arcane_charge, clearcasting
4:21.208 aoe q arcane_explosion Fluffy_Pillow 57495.7/63371: 91% mana arcane_charge(2)
4:22.514 aoe q arcane_explosion Fluffy_Pillow 54150.9/63371: 85% mana arcane_charge(3)
4:23.820 shared_cds t use_mana_gem Kyrian_Pelagos 50806.2/63371: 80% mana arcane_charge(4), clearcasting
4:23.820 aoe r arcane_barrage Fluffy_Pillow 57143.3/63371: 90% mana arcane_charge(4), clearcasting
4:25.126 aoe k radiant_spark Fluffy_Pillow 61333.4/63371: 97% mana clearcasting
4:26.434 aoe m touch_of_the_magi Fluffy_Pillow 67860.6/69371: 98% mana clearcasting, combat_meditation
4:27.740 aoe n arcane_power Fluffy_Pillow 66877.0/69371: 96% mana arcane_charge(4), clearcasting, combat_meditation
4:27.740 shared_cds v berserking Fluffy_Pillow 66877.0/69371: 96% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, combat_meditation
4:27.740 aoe r arcane_barrage Fluffy_Pillow 66877.0/69371: 96% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, combat_meditation
4:28.929 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana berserking, arcane_power, clearcasting, rune_of_power, combat_meditation
4:30.117 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana berserking, arcane_charge, arcane_power, rune_of_power, combat_meditation

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Pelagos"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=328266//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Emeni : 17571 dps, 4823 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17571.5 17571.5 34.7 / 0.198% 2105.5 / 12.0% 8.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
2048.7 1945.7 Mana 0.00% 49.6 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 17571
Arcane Barrage 6159 35.1% 56.6 5.28sec 32618 26151 Direct 282.5 5483 10920 6537 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.57 282.47 0.00 0.00 1.2473 0.0000 1845365.22 1845365.22 0.00% 26150.54 26150.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 227.73 170 283 5482.91 2082 31802 5464.21 4776 6069 1247843 1247843 0.00%
crit 19.38% 54.74 27 87 10920.00 4164 63605 10890.00 7529 15030 597522 597522 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [q]:56.58
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.00
Arcane Blast 0 0.0% 0.0 0.00sec 2296 2255 Direct 0.0 2296 0 2296 0.0%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.3040 0.0000 2.26 2.26 0.00% 2255.20 2255.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 0.00 0 1 2295.79 2296 2296 2.26 0 2296 2 2 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    rotation
    [t]:0.00
Arcane Echo 432 2.5% 36.0 7.80sec 3582 0 Direct 180.1 600 1201 717 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.01 180.06 0.00 0.00 0.0000 0.0000 129000.45 129000.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 145.08 102 192 599.88 443 841 599.19 543 685 87011 87011 0.00%
crit 19.43% 34.98 18 60 1200.99 886 1681 1199.19 965 1409 41989 41989 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 8365 47.6% 153.2 1.92sec 16311 13131 Direct 766.2 2738 5464 3263 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.25 766.23 0.00 0.00 1.2421 0.0000 2499620.72 2499620.72 0.00% 13131.43 13131.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 618.51 487 767 2737.70 1958 5201 2736.39 2584 2859 1692773 1692773 0.00%
crit 19.28% 147.73 91 206 5463.61 3916 10402 5460.56 4796 6053 806847 806847 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [p]:153.26
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1500) 0.0% (8.5%) 12.9 23.81sec 34669 27815

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.94 0.00 0.00 0.00 1.2465 0.0000 0.00 0.00 0.00% 27814.64 27814.64

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [o]:12.94
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [s]:0.00
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 1500 8.5% 64.6 23.81sec 6944 0 Direct 64.6 5790 11707 6946 19.5%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.58 64.58 0.00 0.00 0.0000 0.0000 448455.41 448455.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 51.97 32 71 5790.44 3869 10279 5784.50 4971 6347 300792 300792 0.00%
crit 19.53% 12.61 3 25 11707.30 7739 20558 11708.44 8358 16669 147663 147663 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.4%) 14.5 1.82sec 1389 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.53 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.4% 14.5 1.82sec 1389 0 Direct 14.5 1164 2327 1390 19.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.53 14.53 0.00 0.00 0.0000 0.0000 20188.07 20188.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 11.72 5 20 1163.53 1164 1164 1163.53 1164 1164 13632 13632 0.00%
crit 19.38% 2.82 0 9 2327.06 2327 2327 2212.77 0 2327 6556 6556 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1754 18.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1755.58 1755.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.43% 0.81 0 1 1480.68 1481 1481 1205.78 0 1481 1206 1206 0.00%
crit 18.57% 0.19 0 1 2961.35 2961 2961 549.80 0 2961 550 550 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (23) 0.0% (0.1%) 1.0 0.00sec 6857 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 171  / 23 0.1% 90.0 1.29sec 76 58 Direct 90.0 64 128 76 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6856.86 6856.86 0.00% 58.22 58.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 72.61 58 82 63.86 43 69 63.87 62 66 4637 4637 0.00%
crit 19.32% 17.39 8 32 127.65 86 139 127.64 112 139 2220 2220 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (1018) 0.0% (5.8%) 6.0 53.09sec 50476 40163

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.04 0.00 0.00 0.00 1.2568 0.0000 0.00 0.00 0.00% 40163.09 40163.09

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.06
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1018 5.8% 6.0 52.98sec 50476 0 Direct 30.1 10151 0 10151 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.04 30.06 0.00 0.00 0.0000 0.0000 304837.83 304837.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.06 25 35 10150.82 2143 63138 10113.79 6942 14022 304838 304838 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10179.26
  • base_dd_max:10179.26
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Emeni
Arcane Power 2.8 128.50sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.83
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 257.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [x]:1.83
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.8 257.19sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.85
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 1.2 172.37sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.17 0.00 6.97 0.00 4.3053 0.7221 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [r]:1.17
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.0 0.00sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.00
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
Rune of Power 5.9 51.47sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.85 0.00 0.00 0.00 1.2552 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.87
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.08sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.3 179.5 5.2sec 1.3sec 3.8sec 73.58% 0.00% 26.7 (26.7) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:19.02%
  • arcane_charge_2:16.34%
  • arcane_charge_3:16.72%
  • arcane_charge_4:21.50%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.6sec 128.6sec 14.6sec 13.85% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.85%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 257.3sec 257.3sec 11.6sec 7.06% 23.57% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.9s / 263.2s
  • trigger_min/max:241.9s / 263.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.06%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.4 0.1 11.8sec 11.8sec 2.0sec 15.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.80%
  • clearcasting_2:0.11%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.8 0.0 257.4sec 257.4sec 19.0sec 11.58% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:242.9s / 262.9s
  • trigger_min/max:242.9s / 262.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • deathborne_1:11.58%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 1.2 0.0 171.3sec 171.3sec 4.3sec 1.69% 0.00% 4.6 (4.6) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.6s / 259.1s
  • trigger_min/max:90.6s / 259.1s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 4.3s

Stack Uptimes

  • evocation_1:1.69%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Lead by Example 1.8 0.0 257.4sec 257.4sec 27.9sec 16.93% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:242.9s / 262.9s
  • trigger_min/max:242.9s / 262.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • lead_by_example_1:16.93%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.48%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.0 0.0 0.0sec 0.0sec 292.0sec 97.66% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:233.2s / 353.0s

Stack Uptimes

  • presence_of_mind_2:0.01%
  • presence_of_mind_3:97.65%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.7 0.0 35.8sec 35.8sec 14.7sec 42.56% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 55.3s
  • trigger_min/max:15.7s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.56%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 2 0.00% 0.00% 3.77%
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.89%
Arcane Barrage Arcane Charge 4 99.99% 94.34% 100.00%
Arcane Blast Arcane Charge 1 0.10% 0.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.71% 0.51% 5.84% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.911120.053239.917
Evocation142.7030.565310.486212.515132.022336.009
Rune of Power7.4410.04331.31945.88824.43985.379
Touch of the Magi5.8410.00027.33437.52223.13184.073
Arcane Power6.4110.36918.91618.5292.72025.525
Arcane Barrage2.7870.0009.578158.757126.285192.155
Arcane Orb3.7290.00010.48648.60035.03063.794
Deathborne34.7140.00081.60974.95158.751135.569
Presence of Mind6.8856.8766.8946.8856.8766.894

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
mana_regen Mana 507.96 370115.05 63.64% 728.62 8119.82 2.15%
Evocation Mana 55.78 56078.63 9.64% 1005.29 0.00 0.00%
Mana Gem Mana 2.74 17362.79 2.99% 6337.14 0.00 0.00%
Arcane Barrage Mana 56.58 138032.08 23.73% 2439.58 5387.76 3.76%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1945.70 2048.67 13523.2 32593.2 239.1 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
arcane_blast Mana 0.0 2.7 2750.0 2707.4 0.8
arcane_explosion Mana 153.3 585858.3 3822.7 3823.0 4.3
arcane_orb Mana 12.9 5804.6 448.7 448.7 77.3
deathborne Mana 1.8 4596.2 2500.0 2503.5 0.0
touch_of_the_magi Mana 6.0 15096.7 2500.0 2499.7 20.2

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Necrolord_Emeni Damage Per Second
Count 1018
Mean 17571.46
Minimum 16011.88
Maximum 18969.03
Spread ( max - min ) 2957.16
Range [ ( max - min ) / 2 * 100% ] 8.41%
Standard Deviation 564.9962
5th Percentile 16566.73
95th Percentile 18411.60
( 95th Percentile - 5th Percentile ) 1844.86
Mean Distribution
Standard Deviation 17.7081
95.00% Confidence Interval ( 17536.75 - 17606.17 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3972
0.1 Scale Factor Error with Delta=300 2726
0.05 Scale Factor Error with Delta=300 10901
0.01 Scale Factor Error with Delta=300 272506
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 1018
Mean 4822.75
Minimum 4137.01
Maximum 5510.96
Spread ( max - min ) 1373.94
Range [ ( max - min ) / 2 * 100% ] 14.24%
Standard Deviation 213.3618
5th Percentile 4470.17
95th Percentile 5169.77
( 95th Percentile - 5th Percentile ) 699.60
Mean Distribution
Standard Deviation 6.6872
95.00% Confidence Interval ( 4809.65 - 4835.86 )
Normalized 95.00% Confidence Interval ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7519
0.1 Scale Factor Error with Delta=300 389
0.05 Scale Factor Error with Delta=300 1555
0.01 Scale Factor Error with Delta=300 38862
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 1018
Mean 17571.46
Minimum 16011.88
Maximum 18969.03
Spread ( max - min ) 2957.16
Range [ ( max - min ) / 2 * 100% ] 8.41%
Damage
Necrolord_Emeni Damage
Count 1018
Mean 5249225.53
Minimum 4019884.98
Maximum 6387883.82
Spread ( max - min ) 2367998.84
Range [ ( max - min ) / 2 * 100% ] 22.56%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.85 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.06 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.83 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.87 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
o 12.94 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
p 153.26 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
q 56.58 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
r 1.17 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
s 0.00 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
t 0.00 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
u 0.00 arcane_barrage
actions.shared_cds
# count action,conditions
v 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
x 1.83 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklwxqoqppnppqppppqppppmqppvppqoqppppqppppqppppqppppqoqppppqppppqkmqppppqoqppppqprpppqoqppppqppppqpkmqoqppppqpppplqppppqoqpvpppqppppqppppqkmqoqppppqppppqppppqoqppppqppppqppppqkmqoqppppqppppqprpppqoqppppqppppqkjlxqpppvpqoqppp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, deathborne, lead_by_example
0:02.311 aoe l arcane_power Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge(4), deathborne, lead_by_example
0:02.311 shared_cds w potion Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
0:02.311 shared_cds x berserking Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:02.311 aoe q arcane_barrage Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:03.226 aoe o arcane_orb Fluffy_Pillow 63344.8/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:04.141 aoe q arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.055 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.970 aoe p arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.883 aoe n presence_of_mind Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.883 aoe p arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:07.796 aoe p arcane_explosion Fluffy_Pillow 59345.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:08.711 aoe q arcane_barrage Fluffy_Pillow 58005.1/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:09.626 aoe p arcane_explosion Fluffy_Pillow 61699.7/63371: 97% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:10.540 aoe p arcane_explosion Fluffy_Pillow 60358.1/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:11.454 aoe p arcane_explosion Fluffy_Pillow 59016.6/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:12.367 aoe p arcane_explosion Fluffy_Pillow 57673.7/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:13.279 aoe q arcane_barrage Fluffy_Pillow 56329.6/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:14.194 aoe p arcane_explosion Fluffy_Pillow 60024.2/63371: 95% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:15.108 aoe p arcane_explosion Fluffy_Pillow 58682.6/63371: 93% mana bloodlust, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:16.115 aoe p arcane_explosion Fluffy_Pillow 57458.9/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:17.121 aoe p arcane_explosion Fluffy_Pillow 56233.9/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:18.127 aoe m rune_of_power Fluffy_Pillow 55009.0/63371: 87% mana bloodlust, arcane_charge(4), presence_of_mind(3), deathborne, lead_by_example, potion_of_deathly_fixation
0:19.133 aoe q arcane_barrage Fluffy_Pillow 56284.0/63371: 89% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:20.141 aoe p arcane_explosion Fluffy_Pillow 60096.4/63371: 95% mana bloodlust, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:21.147 aoe p arcane_explosion Fluffy_Pillow 56371.5/63371: 89% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:22.153 shared_cds v use_mana_gem Necrolord_Emeni 52646.5/63371: 83% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:22.153 aoe p arcane_explosion Fluffy_Pillow 58983.6/63371: 93% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:23.159 aoe p arcane_explosion Fluffy_Pillow 55258.7/63371: 87% mana bloodlust, arcane_charge(3), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:24.165 aoe q arcane_barrage Fluffy_Pillow 51533.7/63371: 81% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:25.170 aoe o arcane_orb Fluffy_Pillow 55342.3/63371: 87% mana bloodlust, presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:26.177 aoe q arcane_barrage Fluffy_Pillow 56118.6/63371: 89% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:27.179 aoe p arcane_explosion Fluffy_Pillow 59923.4/63371: 95% mana bloodlust, presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:28.186 aoe p arcane_explosion Fluffy_Pillow 56199.7/63371: 89% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power, lead_by_example
0:29.192 aoe p arcane_explosion Fluffy_Pillow 52474.8/63371: 83% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, lead_by_example
0:30.199 aoe p arcane_explosion Fluffy_Pillow 48751.1/63371: 77% mana bloodlust, arcane_charge(3), presence_of_mind(3), rune_of_power, lead_by_example
0:31.207 aoe q arcane_barrage Fluffy_Pillow 45028.6/63371: 71% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example
0:32.214 aoe p arcane_explosion Fluffy_Pillow 48839.8/63371: 77% mana bloodlust, presence_of_mind(3), rune_of_power
0:33.220 aoe p arcane_explosion Fluffy_Pillow 45114.8/63371: 71% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power
0:34.228 aoe p arcane_explosion Fluffy_Pillow 41392.4/63371: 65% mana bloodlust, arcane_charge(2), presence_of_mind(3)
0:35.235 aoe p arcane_explosion Fluffy_Pillow 37668.7/63371: 59% mana bloodlust, arcane_charge(3), presence_of_mind(3)
0:36.241 aoe q arcane_barrage Fluffy_Pillow 33943.7/63371: 54% mana bloodlust, arcane_charge(4), clearcasting, presence_of_mind(3)
0:37.247 aoe p arcane_explosion Fluffy_Pillow 37753.6/63371: 60% mana bloodlust, clearcasting, presence_of_mind(3)
0:38.253 aoe p arcane_explosion Fluffy_Pillow 39028.7/63371: 62% mana bloodlust, arcane_charge, presence_of_mind(3)
0:39.260 aoe p arcane_explosion Fluffy_Pillow 35305.0/63371: 56% mana bloodlust, arcane_charge(2), presence_of_mind(3)
0:40.266 aoe p arcane_explosion Fluffy_Pillow 31580.0/63371: 50% mana bloodlust, arcane_charge(3), presence_of_mind(3)
0:41.272 aoe q arcane_barrage Fluffy_Pillow 27855.0/63371: 44% mana arcane_charge(4), presence_of_mind(3)
0:42.578 aoe p arcane_explosion Fluffy_Pillow 32045.2/63371: 51% mana presence_of_mind(3)
0:43.884 aoe p arcane_explosion Fluffy_Pillow 28700.4/63371: 45% mana arcane_charge, presence_of_mind(3)
0:45.190 aoe p arcane_explosion Fluffy_Pillow 25355.7/63371: 40% mana arcane_charge(2), presence_of_mind(3)
0:46.496 aoe p arcane_explosion Fluffy_Pillow 22010.9/63371: 35% mana arcane_charge(3), presence_of_mind(3)
0:47.802 aoe q arcane_barrage Fluffy_Pillow 18666.2/63371: 29% mana arcane_charge(4), presence_of_mind(3)
0:49.108 aoe o arcane_orb Fluffy_Pillow 22856.3/63371: 36% mana presence_of_mind(3)
0:50.416 aoe q arcane_barrage Fluffy_Pillow 24014.1/63371: 38% mana arcane_charge(4), presence_of_mind(3)
0:51.723 aoe p arcane_explosion Fluffy_Pillow 28205.5/63371: 45% mana presence_of_mind(3)
0:53.029 aoe p arcane_explosion Fluffy_Pillow 24860.8/63371: 39% mana arcane_charge, presence_of_mind(3)
0:54.336 aoe p arcane_explosion Fluffy_Pillow 21517.3/63371: 34% mana arcane_charge(2), presence_of_mind(3)
0:55.642 aoe p arcane_explosion Fluffy_Pillow 18172.6/63371: 29% mana arcane_charge(3), presence_of_mind(3)
0:56.949 aoe q arcane_barrage Fluffy_Pillow 14829.1/63371: 23% mana arcane_charge(4), presence_of_mind(3)
0:58.257 aoe p arcane_explosion Fluffy_Pillow 19021.7/63371: 30% mana presence_of_mind(3)
0:59.564 aoe p arcane_explosion Fluffy_Pillow 15678.3/63371: 25% mana arcane_charge, presence_of_mind(3)
1:00.871 aoe p arcane_explosion Fluffy_Pillow 12334.8/63371: 19% mana arcane_charge(2), presence_of_mind(3)
1:02.177 aoe p arcane_explosion Fluffy_Pillow 8990.1/63371: 14% mana arcane_charge(3), presence_of_mind(3)
1:03.483 aoe q arcane_barrage Fluffy_Pillow 5645.3/63371: 9% mana arcane_charge(4), presence_of_mind(3)
1:04.790 aoe k touch_of_the_magi Fluffy_Pillow 9836.7/63371: 16% mana presence_of_mind(3)
1:06.096 aoe m rune_of_power Fluffy_Pillow 8992.0/63371: 14% mana arcane_charge(4), presence_of_mind(3)
1:07.403 aoe q arcane_barrage Fluffy_Pillow 10648.5/63371: 17% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:08.711 aoe p arcane_explosion Fluffy_Pillow 14841.1/63371: 23% mana presence_of_mind(3), rune_of_power
1:10.018 aoe p arcane_explosion Fluffy_Pillow 11497.7/63371: 18% mana arcane_charge, clearcasting, presence_of_mind(3), rune_of_power
1:11.325 aoe p arcane_explosion Fluffy_Pillow 13154.2/63371: 21% mana arcane_charge(2), presence_of_mind(3), rune_of_power
1:12.631 aoe p arcane_explosion Fluffy_Pillow 9809.5/63371: 15% mana arcane_charge(3), presence_of_mind(3), rune_of_power
1:13.939 aoe q arcane_barrage Fluffy_Pillow 6467.3/63371: 10% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:15.246 aoe o arcane_orb Fluffy_Pillow 10658.7/63371: 17% mana presence_of_mind(3), rune_of_power
1:16.551 aoe q arcane_barrage Fluffy_Pillow 11812.6/63371: 19% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:17.856 aoe p arcane_explosion Fluffy_Pillow 16001.5/63371: 25% mana presence_of_mind(3), rune_of_power
1:19.163 aoe p arcane_explosion Fluffy_Pillow 12658.0/63371: 20% mana arcane_charge, presence_of_mind(3), rune_of_power
1:20.470 aoe p arcane_explosion Fluffy_Pillow 9314.6/63371: 15% mana arcane_charge(2), presence_of_mind(3), rune_of_power
1:21.777 aoe p arcane_explosion Fluffy_Pillow 5971.1/63371: 9% mana arcane_charge(3), presence_of_mind(3), rune_of_power
1:23.084 aoe q arcane_barrage Fluffy_Pillow 2627.6/63371: 4% mana arcane_charge(4), presence_of_mind(3)
1:24.391 aoe p arcane_explosion Fluffy_Pillow 6819.0/63371: 11% mana presence_of_mind(3)
1:25.695 aoe r evocation Necrolord_Emeni 3471.7/63371: 5% mana arcane_charge, presence_of_mind(3)
1:30.040 aoe p arcane_explosion Fluffy_Pillow 57317.7/63371: 90% mana arcane_charge, presence_of_mind(3)
1:31.348 aoe p arcane_explosion Fluffy_Pillow 53975.5/63371: 85% mana arcane_charge(2), presence_of_mind(3)
1:32.653 aoe p arcane_explosion Fluffy_Pillow 50629.5/63371: 80% mana arcane_charge(3), presence_of_mind(3)
1:33.959 aoe q arcane_barrage Fluffy_Pillow 47284.7/63371: 75% mana arcane_charge(4), presence_of_mind(3)
1:35.268 aoe o arcane_orb Fluffy_Pillow 51478.6/63371: 81% mana presence_of_mind(3)
1:36.576 aoe q arcane_barrage Fluffy_Pillow 52636.4/63371: 83% mana arcane_charge(4), presence_of_mind(3)
1:37.883 aoe p arcane_explosion Fluffy_Pillow 56827.8/63371: 90% mana presence_of_mind(3)
1:39.191 aoe p arcane_explosion Fluffy_Pillow 53485.6/63371: 84% mana arcane_charge, clearcasting, presence_of_mind(3)
1:40.498 aoe p arcane_explosion Fluffy_Pillow 55142.1/63371: 87% mana arcane_charge(2), presence_of_mind(3)
1:41.805 aoe p arcane_explosion Fluffy_Pillow 51798.7/63371: 82% mana arcane_charge(3), clearcasting, presence_of_mind(3)
1:43.110 aoe q arcane_barrage Fluffy_Pillow 53452.7/63371: 84% mana arcane_charge(4), presence_of_mind(3)
1:44.416 aoe p arcane_explosion Fluffy_Pillow 57642.8/63371: 91% mana presence_of_mind(3)
1:45.722 aoe p arcane_explosion Fluffy_Pillow 54298.0/63371: 86% mana arcane_charge, presence_of_mind(3)
1:47.030 aoe p arcane_explosion Fluffy_Pillow 50955.8/63371: 80% mana arcane_charge(2), presence_of_mind(3)
1:48.337 aoe p arcane_explosion Fluffy_Pillow 47612.4/63371: 75% mana arcane_charge(3), presence_of_mind(3)
1:49.643 aoe q arcane_barrage Fluffy_Pillow 44267.6/63371: 70% mana arcane_charge(4), presence_of_mind(3)
1:50.949 aoe p arcane_explosion Fluffy_Pillow 48457.8/63371: 76% mana presence_of_mind(3)
1:52.256 aoe k touch_of_the_magi Fluffy_Pillow 45114.3/63371: 71% mana arcane_charge, presence_of_mind(3)
1:53.562 aoe m rune_of_power Fluffy_Pillow 44269.5/63371: 70% mana arcane_charge(4), presence_of_mind(3)
1:54.866 aoe q arcane_barrage Fluffy_Pillow 45922.3/63371: 72% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:56.172 aoe o arcane_orb Fluffy_Pillow 50112.4/63371: 79% mana presence_of_mind(3), rune_of_power
1:57.480 aoe q arcane_barrage Fluffy_Pillow 51270.2/63371: 81% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:58.787 aoe p arcane_explosion Fluffy_Pillow 55461.6/63371: 88% mana presence_of_mind(3), rune_of_power
2:00.094 aoe p arcane_explosion Fluffy_Pillow 52118.1/63371: 82% mana arcane_charge, clearcasting, presence_of_mind(3), rune_of_power
2:01.402 aoe p arcane_explosion Fluffy_Pillow 53775.9/63371: 85% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:02.709 aoe p arcane_explosion Fluffy_Pillow 50432.4/63371: 80% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:04.017 aoe q arcane_barrage Fluffy_Pillow 47090.2/63371: 74% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
2:05.323 aoe p arcane_explosion Fluffy_Pillow 51280.3/63371: 81% mana clearcasting, presence_of_mind(3), rune_of_power
2:06.630 aoe p arcane_explosion Fluffy_Pillow 52936.9/63371: 84% mana arcane_charge, presence_of_mind(3), rune_of_power
2:07.936 aoe p arcane_explosion Fluffy_Pillow 49592.1/63371: 78% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:09.243 aoe p arcane_explosion Fluffy_Pillow 46248.7/63371: 73% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:10.549 aoe l arcane_power Fluffy_Pillow 42903.9/63371: 68% mana arcane_charge(4), presence_of_mind(3)
2:10.549 aoe q arcane_barrage Fluffy_Pillow 42903.9/63371: 68% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:11.856 aoe p arcane_explosion Fluffy_Pillow 47095.3/63371: 74% mana arcane_power, presence_of_mind(3), rune_of_power
2:13.162 aoe p arcane_explosion Fluffy_Pillow 46250.6/63371: 73% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:14.470 aoe p arcane_explosion Fluffy_Pillow 45408.4/63371: 72% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power
2:15.777 aoe p arcane_explosion Fluffy_Pillow 44564.9/63371: 70% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:17.083 aoe q arcane_barrage Fluffy_Pillow 43720.2/63371: 69% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:18.390 aoe o arcane_orb Fluffy_Pillow 47911.5/63371: 76% mana arcane_power, presence_of_mind(3), rune_of_power
2:19.698 aoe q arcane_barrage Fluffy_Pillow 49319.3/63371: 78% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:21.005 aoe p arcane_explosion Fluffy_Pillow 53510.7/63371: 84% mana arcane_power, presence_of_mind(3), rune_of_power
2:22.312 shared_cds v use_mana_gem Necrolord_Emeni 52667.3/63371: 83% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:22.312 aoe p arcane_explosion Fluffy_Pillow 59004.4/63371: 93% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:23.619 aoe p arcane_explosion Fluffy_Pillow 58160.9/63371: 92% mana arcane_charge(2), arcane_power, clearcasting, presence_of_mind(3), rune_of_power
2:24.925 aoe p arcane_explosion Fluffy_Pillow 59816.2/63371: 94% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:26.232 aoe q arcane_barrage Fluffy_Pillow 58972.7/63371: 93% mana arcane_charge(4), presence_of_mind(3)
2:27.538 aoe p arcane_explosion Fluffy_Pillow 63162.8/63371: 100% mana presence_of_mind(3)
2:28.843 aoe p arcane_explosion Fluffy_Pillow 59816.8/63371: 94% mana arcane_charge, presence_of_mind(3)
2:30.150 aoe p arcane_explosion Fluffy_Pillow 56473.4/63371: 89% mana arcane_charge(2), presence_of_mind(3)
2:31.457 aoe p arcane_explosion Fluffy_Pillow 53129.9/63371: 84% mana arcane_charge(3), presence_of_mind(3)
2:32.763 aoe q arcane_barrage Fluffy_Pillow 49785.2/63371: 79% mana arcane_charge(4), presence_of_mind(3)
2:34.068 aoe p arcane_explosion Fluffy_Pillow 53974.0/63371: 85% mana presence_of_mind(3)
2:35.374 aoe p arcane_explosion Fluffy_Pillow 50629.3/63371: 80% mana arcane_charge, clearcasting, presence_of_mind(3)
2:36.680 aoe p arcane_explosion Fluffy_Pillow 52284.5/63371: 83% mana arcane_charge(2), presence_of_mind(3)
2:37.986 aoe p arcane_explosion Fluffy_Pillow 48939.8/63371: 77% mana arcane_charge(3), presence_of_mind(3)
2:39.292 aoe q arcane_barrage Fluffy_Pillow 45595.1/63371: 72% mana arcane_charge(4), presence_of_mind(3)
2:40.597 aoe k touch_of_the_magi Fluffy_Pillow 49783.9/63371: 79% mana presence_of_mind(3)
2:41.903 aoe m rune_of_power Fluffy_Pillow 48939.2/63371: 77% mana arcane_charge(4), presence_of_mind(3)
2:43.211 aoe q arcane_barrage Fluffy_Pillow 50597.0/63371: 80% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:44.516 aoe o arcane_orb Fluffy_Pillow 54785.8/63371: 86% mana presence_of_mind(3), rune_of_power
2:45.824 aoe q arcane_barrage Fluffy_Pillow 55943.6/63371: 88% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:47.131 aoe p arcane_explosion Fluffy_Pillow 60135.0/63371: 95% mana presence_of_mind(3), rune_of_power
2:48.435 aoe p arcane_explosion Fluffy_Pillow 56787.7/63371: 90% mana arcane_charge, presence_of_mind(3), rune_of_power
2:49.743 aoe p arcane_explosion Fluffy_Pillow 53445.5/63371: 84% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:51.048 aoe p arcane_explosion Fluffy_Pillow 50099.5/63371: 79% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:52.356 aoe q arcane_barrage Fluffy_Pillow 46757.3/63371: 74% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:53.663 aoe p arcane_explosion Fluffy_Pillow 50948.7/63371: 80% mana presence_of_mind(3), rune_of_power
2:54.969 aoe p arcane_explosion Fluffy_Pillow 47604.0/63371: 75% mana arcane_charge, presence_of_mind(3), rune_of_power
2:56.276 aoe p arcane_explosion Fluffy_Pillow 44260.5/63371: 70% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:57.582 aoe p arcane_explosion Fluffy_Pillow 40915.7/63371: 65% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:58.886 aoe q arcane_barrage Fluffy_Pillow 37568.5/63371: 59% mana arcane_charge(4), presence_of_mind(3)
3:00.191 aoe p arcane_explosion Fluffy_Pillow 41757.3/63371: 66% mana presence_of_mind(3)
3:01.496 aoe p arcane_explosion Fluffy_Pillow 38411.3/63371: 61% mana arcane_charge, presence_of_mind(3)
3:02.804 aoe p arcane_explosion Fluffy_Pillow 35069.1/63371: 55% mana arcane_charge(2), presence_of_mind(3)
3:04.111 aoe p arcane_explosion Fluffy_Pillow 31725.6/63371: 50% mana arcane_charge(3), presence_of_mind(3)
3:05.418 aoe q arcane_barrage Fluffy_Pillow 28382.2/63371: 45% mana arcane_charge(4), presence_of_mind(3)
3:06.724 aoe o arcane_orb Fluffy_Pillow 32572.3/63371: 51% mana presence_of_mind(3)
3:08.032 aoe q arcane_barrage Fluffy_Pillow 33730.1/63371: 53% mana arcane_charge(4), presence_of_mind(3)
3:09.339 aoe p arcane_explosion Fluffy_Pillow 37921.5/63371: 60% mana presence_of_mind(3)
3:10.647 aoe p arcane_explosion Fluffy_Pillow 34579.3/63371: 55% mana arcane_charge, presence_of_mind(3)
3:11.955 aoe p arcane_explosion Fluffy_Pillow 31237.1/63371: 49% mana arcane_charge(2), presence_of_mind(3)
3:13.262 aoe p arcane_explosion Fluffy_Pillow 27893.6/63371: 44% mana arcane_charge(3), presence_of_mind(3)
3:14.569 aoe q arcane_barrage Fluffy_Pillow 24550.1/63371: 39% mana arcane_charge(4), presence_of_mind(3)
3:15.877 aoe p arcane_explosion Fluffy_Pillow 28742.8/63371: 45% mana presence_of_mind(3)
3:17.185 aoe p arcane_explosion Fluffy_Pillow 25400.6/63371: 40% mana arcane_charge, presence_of_mind(3)
3:18.493 aoe p arcane_explosion Fluffy_Pillow 22058.4/63371: 35% mana arcane_charge(2), presence_of_mind(3)
3:19.799 aoe p arcane_explosion Fluffy_Pillow 18713.6/63371: 30% mana arcane_charge(3), presence_of_mind(3)
3:21.105 aoe q arcane_barrage Fluffy_Pillow 15368.9/63371: 24% mana arcane_charge(4), presence_of_mind(3)
3:22.411 aoe p arcane_explosion Fluffy_Pillow 19559.0/63371: 31% mana presence_of_mind(3)
3:23.719 aoe p arcane_explosion Fluffy_Pillow 16216.8/63371: 26% mana arcane_charge, presence_of_mind(3)
3:25.025 aoe p arcane_explosion Fluffy_Pillow 12872.1/63371: 20% mana arcane_charge(2), presence_of_mind(3)
3:26.333 aoe p arcane_explosion Fluffy_Pillow 9529.9/63371: 15% mana arcane_charge(3), clearcasting, presence_of_mind(3)
3:27.640 aoe q arcane_barrage Fluffy_Pillow 11186.4/63371: 18% mana arcane_charge(4), presence_of_mind(3)
3:28.947 aoe k touch_of_the_magi Fluffy_Pillow 15377.8/63371: 24% mana presence_of_mind(3)
3:30.253 aoe m rune_of_power Fluffy_Pillow 14533.1/63371: 23% mana arcane_charge(4), presence_of_mind(3)
3:31.559 aoe q arcane_barrage Fluffy_Pillow 16188.3/63371: 26% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:32.864 aoe o arcane_orb Fluffy_Pillow 20377.2/63371: 32% mana presence_of_mind(3), rune_of_power
3:34.168 aoe q arcane_barrage Fluffy_Pillow 21529.9/63371: 34% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:35.475 aoe p arcane_explosion Fluffy_Pillow 25721.3/63371: 41% mana presence_of_mind(3), rune_of_power
3:36.782 aoe p arcane_explosion Fluffy_Pillow 22377.8/63371: 35% mana arcane_charge, presence_of_mind(3), rune_of_power
3:38.089 aoe p arcane_explosion Fluffy_Pillow 19034.3/63371: 30% mana arcane_charge(2), presence_of_mind(3), rune_of_power
3:39.394 aoe p arcane_explosion Fluffy_Pillow 15688.3/63371: 25% mana arcane_charge(3), presence_of_mind(3), rune_of_power
3:40.701 aoe q arcane_barrage Fluffy_Pillow 12344.9/63371: 19% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:42.009 aoe p arcane_explosion Fluffy_Pillow 16537.5/63371: 26% mana presence_of_mind(3), rune_of_power
3:43.315 aoe p arcane_explosion Fluffy_Pillow 13192.8/63371: 21% mana arcane_charge, presence_of_mind(3), rune_of_power
3:44.622 aoe p arcane_explosion Fluffy_Pillow 9849.3/63371: 16% mana arcane_charge(2), presence_of_mind(3), rune_of_power
3:45.927 aoe p arcane_explosion Fluffy_Pillow 6503.3/63371: 10% mana arcane_charge(3), presence_of_mind(3), rune_of_power
3:47.232 aoe q arcane_barrage Fluffy_Pillow 3157.3/63371: 5% mana arcane_charge(4), presence_of_mind(3)
3:48.538 aoe p arcane_explosion Fluffy_Pillow 7347.4/63371: 12% mana presence_of_mind(3)
3:49.846 aoe r evocation Fluffy_Pillow 4005.2/63371: 6% mana arcane_charge, presence_of_mind(3)
3:54.191 aoe p arcane_explosion Fluffy_Pillow 57851.1/63371: 91% mana arcane_charge, presence_of_mind(3)
3:55.498 aoe p arcane_explosion Fluffy_Pillow 54507.7/63371: 86% mana arcane_charge(2), presence_of_mind(3)
3:56.805 aoe p arcane_explosion Fluffy_Pillow 51164.2/63371: 81% mana arcane_charge(3), presence_of_mind(3)
3:58.111 aoe q arcane_barrage Fluffy_Pillow 47819.5/63371: 75% mana arcane_charge(4), presence_of_mind(3)
3:59.419 aoe o arcane_orb Fluffy_Pillow 52012.1/63371: 82% mana presence_of_mind(3)
4:00.728 aoe q arcane_barrage Fluffy_Pillow 53171.2/63371: 84% mana arcane_charge(4), presence_of_mind(3)
4:02.034 aoe p arcane_explosion Fluffy_Pillow 57361.3/63371: 91% mana presence_of_mind(3)
4:03.339 aoe p arcane_explosion Fluffy_Pillow 54015.3/63371: 85% mana arcane_charge, presence_of_mind(3)
4:04.646 aoe p arcane_explosion Fluffy_Pillow 50671.8/63371: 80% mana arcane_charge(2), presence_of_mind(3)
4:05.951 aoe p arcane_explosion Fluffy_Pillow 47325.8/63371: 75% mana arcane_charge(3), clearcasting, presence_of_mind(3)
4:07.256 aoe q arcane_barrage Fluffy_Pillow 48979.8/63371: 77% mana arcane_charge(4), presence_of_mind(3)
4:08.561 aoe p arcane_explosion Fluffy_Pillow 53168.7/63371: 84% mana presence_of_mind(3)
4:09.867 aoe p arcane_explosion Fluffy_Pillow 49823.9/63371: 79% mana arcane_charge, clearcasting, presence_of_mind(3)
4:11.175 aoe p arcane_explosion Fluffy_Pillow 51481.7/63371: 81% mana arcane_charge(2), presence_of_mind(3)
4:12.482 aoe p arcane_explosion Fluffy_Pillow 48138.2/63371: 76% mana arcane_charge(3), presence_of_mind(3)
4:13.789 aoe q arcane_barrage Fluffy_Pillow 44794.8/63371: 71% mana arcane_charge(4), clearcasting, presence_of_mind(3)
4:15.097 aoe k touch_of_the_magi Fluffy_Pillow 48987.4/63371: 77% mana clearcasting, presence_of_mind(3)
4:16.557 aoe j deathborne Fluffy_Pillow 48337.9/63371: 76% mana arcane_charge(4), clearcasting, presence_of_mind(3)
4:17.865 aoe l arcane_power Fluffy_Pillow 47495.7/63371: 75% mana arcane_charge(4), clearcasting, presence_of_mind(3), deathborne, lead_by_example
4:17.865 shared_cds x berserking Fluffy_Pillow 47495.7/63371: 75% mana arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:17.865 aoe q arcane_barrage Fluffy_Pillow 47495.7/63371: 75% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:19.054 aoe p arcane_explosion Fluffy_Pillow 51537.5/63371: 81% mana berserking, arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:20.243 aoe p arcane_explosion Fluffy_Pillow 53044.5/63371: 84% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:21.431 aoe p arcane_explosion Fluffy_Pillow 52050.2/63371: 82% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:22.618 shared_cds v use_mana_gem Necrolord_Emeni 51054.6/63371: 81% mana berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:22.618 aoe p arcane_explosion Fluffy_Pillow 57391.8/63371: 91% mana berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:23.807 aoe q arcane_barrage Fluffy_Pillow 56398.7/63371: 89% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:24.997 aoe o arcane_orb Fluffy_Pillow 60441.8/63371: 95% mana berserking, arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:26.187 aoe q arcane_barrage Fluffy_Pillow 61700.1/63371: 97% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:27.375 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:28.565 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:29.752 aoe p arcane_explosion Fluffy_Pillow 62375.9/63371: 98% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Emeni"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=342156//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Marileth : 16798 dps, 4611 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16798.4 16798.4 28.6 / 0.170% 1773.6 / 10.6% 8.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
2050.0 1942.1 Mana 0.00% 49.6 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Marileth 16798
Arcane Barrage 5897 35.2% 56.6 5.28sec 31212 25023 Direct 282.5 5226 10523 6254 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.57 282.46 0.00 0.00 1.2473 0.0000 1765654.34 1765654.34 0.00% 25023.45 25023.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 227.65 173 291 5226.16 2082 27654 5213.58 4598 5780 1189220 1189220 0.00%
crit 19.40% 54.81 29 83 10523.00 4164 55308 10491.70 7207 14519 576435 576435 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [q]:56.57
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 402 2.4% 36.0 7.82sec 3335 0 Direct 179.8 559 1118 667 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.95 179.76 0.00 0.00 0.0000 0.0000 119911.21 119911.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 144.93 102 194 558.73 443 731 558.10 512 627 80954 80954 0.00%
crit 19.38% 34.84 14 55 1118.38 886 1462 1117.35 965 1292 38957 38957 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 8031 47.8% 153.4 1.92sec 15643 12594 Direct 766.8 2624 5243 3130 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.36 766.81 0.00 0.00 1.2421 0.0000 2399087.24 2399087.24 0.00% 12593.83 12593.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 618.74 477 773 2623.58 1958 4523 2623.19 2512 2724 1622897 1622897 0.00%
crit 19.31% 148.07 98 210 5243.00 3916 9045 5243.16 4798 5745 776190 776190 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [p]:153.37
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1428) 0.0% (8.5%) 12.9 23.82sec 33047 26514

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.92 0.00 0.00 0.00 1.2464 0.0000 0.00 0.00 0.00% 26514.36 26514.36

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [o]:12.92
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1428 8.5% 64.5 23.82sec 6622 0 Direct 64.5 5549 11118 6624 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.46 64.46 0.00 0.00 0.0000 0.0000 426881.16 426881.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 52.02 34 70 5549.01 3869 8938 5545.73 4895 6021 288552 288552 0.00%
crit 19.30% 12.44 3 24 11117.88 7739 17876 11110.38 8181 14425 138329 138329 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.76sec 1383 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.76sec 1383 0 Direct 14.7 1164 2327 1383 18.8%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.74 14.74 0.00 0.00 0.0000 0.0000 20380.08 20380.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.15% 11.96 5 18 1163.53 1164 1164 1163.53 1164 1164 13916 13916 0.00%
crit 18.85% 2.78 0 8 2327.06 2327 2327 2221.91 0 2327 6465 6465 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1761 19.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1761.39 1761.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.04% 0.81 0 1 1480.68 1481 1481 1199.96 0 1481 1200 1200 0.00%
crit 18.96% 0.19 0 1 2961.35 2961 2961 561.44 0 2961 561 561 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.1%) 1.0 0.00sec 6101 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 153  / 21 0.1% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6100.63 6100.63 0.00% 51.80 51.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 72.60 60 83 56.80 43 60 56.80 56 58 4123 4123 0.00%
crit 19.34% 17.40 7 30 113.60 86 120 113.64 102 120 1977 1977 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (945) 0.0% (5.6%) 6.0 52.95sec 46790 37232

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.04 0.00 0.00 0.00 1.2568 0.0000 0.00 0.00 0.00% 37231.57 37231.57

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.07
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 945 5.6% 6.0 52.82sec 46790 0 Direct 30.1 9386 0 9386 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.04 30.09 0.00 0.00 0.0000 0.0000 282438.67 282438.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.09 25 35 9386.43 2143 54653 9372.42 6456 13902 282439 282439 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17540.56
  • base_dd_max:17540.56
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Marileth
Arcane Power 2.8 128.82sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.83
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 257.59sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [u]:1.83
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.8 257.61sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.85
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 1.1 162.24sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.15 0.00 6.82 0.00 4.3042 0.7220 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [r]:1.15
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.0 0.00sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.00
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
Rune of Power 5.8 51.38sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.84 0.00 0.00 0.00 1.2552 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.87
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.10sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [s]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.3 179.5 5.2sec 1.3sec 3.8sec 73.57% 0.00% 26.6 (26.7) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:19.03%
  • arcane_charge_2:16.35%
  • arcane_charge_3:16.69%
  • arcane_charge_4:21.50%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.6sec 128.6sec 14.6sec 13.87% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.0s

Stack Uptimes

  • arcane_power_1:13.87%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 257.3sec 257.3sec 11.6sec 7.08% 23.60% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:242.3s / 267.1s
  • trigger_min/max:242.3s / 267.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s

Stack Uptimes

  • berserking_1:7.08%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.4 0.1 11.8sec 11.7sec 1.9sec 15.75% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.66%
  • clearcasting_2:0.10%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.8 0.0 257.4sec 257.4sec 19.0sec 11.61% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:243.3s / 266.8s
  • trigger_min/max:243.3s / 266.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • deathborne_1:11.61%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 1.1 0.0 168.0sec 168.0sec 4.3sec 1.65% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:101.0s / 258.1s
  • trigger_min/max:101.0s / 258.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:1.65%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.48%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.0 0.0 0.0sec 0.0sec 292.0sec 97.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:233.2s / 353.0s

Stack Uptimes

  • presence_of_mind_3:97.66%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.7 0.0 35.8sec 35.8sec 14.7sec 42.59% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 55.3s
  • trigger_min/max:15.7s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.59%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.68% 0.51% 4.97% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.911120.053239.917
Evocation144.88611.021324.854212.273116.343351.798
Rune of Power7.3910.03831.31245.77424.42685.410
Touch of the Magi5.7780.00027.30637.14923.12584.102
Arcane Power6.4140.37218.93218.5192.71329.461
Arcane Barrage2.7860.0009.580158.731126.285193.150
Arcane Orb3.7410.00010.48748.75434.15668.120
Deathborne34.8000.00085.54574.84958.751136.677
Presence of Mind6.8866.8776.8946.8866.8776.894

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Marileth
mana_regen Mana 506.68 370206.93 63.77% 730.66 8008.03 2.12%
Evocation Mana 54.65 54926.28 9.46% 1005.06 0.00 0.00%
Mana Gem Mana 2.73 17319.89 2.98% 6337.14 0.00 0.00%
Arcane Barrage Mana 56.57 138119.24 23.79% 2441.37 5288.96 3.69%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1942.12 2049.99 13299.8 31128.0 488.7 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Marileth
arcane_explosion Mana 153.4 586235.5 3822.4 3822.6 4.1
arcane_orb Mana 12.9 5791.1 448.3 448.3 73.7
deathborne Mana 1.8 4608.3 2500.0 2503.3 0.0
touch_of_the_magi Mana 6.0 15089.5 2500.0 2499.8 18.7

Statistics & Data Analysis

Fight Length
Necrolord_Marileth Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Necrolord_Marileth Damage Per Second
Count 1018
Mean 16798.41
Minimum 15312.94
Maximum 18026.38
Spread ( max - min ) 2713.45
Range [ ( max - min ) / 2 * 100% ] 8.08%
Standard Deviation 465.2053
5th Percentile 16031.16
95th Percentile 17534.63
( 95th Percentile - 5th Percentile ) 1503.46
Mean Distribution
Standard Deviation 14.5804
95.00% Confidence Interval ( 16769.83 - 16826.99 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30
0.1% Error 2947
0.1 Scale Factor Error with Delta=300 1848
0.05 Scale Factor Error with Delta=300 7390
0.01 Scale Factor Error with Delta=300 184746
Priority Target DPS
Necrolord_Marileth Priority Target Damage Per Second
Count 1018
Mean 4610.61
Minimum 3966.44
Maximum 5251.16
Spread ( max - min ) 1284.73
Range [ ( max - min ) / 2 * 100% ] 13.93%
Standard Deviation 191.0363
5th Percentile 4294.31
95th Percentile 4936.83
( 95th Percentile - 5th Percentile ) 642.52
Mean Distribution
Standard Deviation 5.9875
95.00% Confidence Interval ( 4598.87 - 4622.34 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6595
0.1 Scale Factor Error with Delta=300 312
0.05 Scale Factor Error with Delta=300 1247
0.01 Scale Factor Error with Delta=300 31155
DPS(e)
Necrolord_Marileth Damage Per Second (Effective)
Count 1018
Mean 16798.41
Minimum 15312.94
Maximum 18026.38
Spread ( max - min ) 2713.45
Range [ ( max - min ) / 2 * 100% ] 8.08%
Damage
Necrolord_Marileth Damage
Count 1018
Mean 5016114.10
Minimum 3842805.02
Maximum 6104270.03
Spread ( max - min ) 2261465.01
Range [ ( max - min ) / 2 * 100% ] 22.54%
DTPS
Necrolord_Marileth Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Marileth Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Marileth Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Marileth Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Marileth Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Marileth Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_MarilethTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Marileth Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.85 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.07 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.83 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.87 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
o 12.92 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
p 153.37 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
q 56.57 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
r 1.15 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
s 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
t 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
u 1.83 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkltuqoqppnppqppppqppppmqppsppqoqppppqppppqppppqppppqoqppppqppppqkmqppppqoqppppqppppqppppqoqppppqppppqkmqppppqoqpppplqppppqpppspqoqppppqppppqkmqppppqoqppppqppppqppppqoqppppqprkmqppppqoqppppqppppqppppqoqppppqppppqjkluqppsppqoqpp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, deathborne
0:02.313 aoe l arcane_power Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), deathborne
0:02.313 shared_cds t potion Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne
0:02.313 shared_cds u berserking Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:02.313 aoe q arcane_barrage Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:03.227 aoe o arcane_orb Fluffy_Pillow 63346.1/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:04.142 aoe q arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.057 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.971 aoe p arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.886 aoe n presence_of_mind Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.886 aoe p arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:07.798 aoe p arcane_explosion Fluffy_Pillow 59345.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:08.714 aoe q arcane_barrage Fluffy_Pillow 58006.4/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:09.629 aoe p arcane_explosion Fluffy_Pillow 61701.0/63371: 97% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:10.545 aoe p arcane_explosion Fluffy_Pillow 60361.9/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:11.459 aoe p arcane_explosion Fluffy_Pillow 59020.4/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:12.372 aoe p arcane_explosion Fluffy_Pillow 57677.5/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:13.288 aoe q arcane_barrage Fluffy_Pillow 56338.5/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:14.202 aoe p arcane_explosion Fluffy_Pillow 60031.8/63371: 95% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:15.114 aoe p arcane_explosion Fluffy_Pillow 58687.7/63371: 93% mana bloodlust, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:16.121 aoe p arcane_explosion Fluffy_Pillow 57464.0/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:17.129 aoe p arcane_explosion Fluffy_Pillow 56241.5/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:18.137 aoe m rune_of_power Fluffy_Pillow 55019.1/63371: 87% mana bloodlust, arcane_charge(4), presence_of_mind(3), deathborne, potion_of_deathly_fixation
0:19.142 aoe q arcane_barrage Fluffy_Pillow 56292.9/63371: 89% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:20.147 aoe p arcane_explosion Fluffy_Pillow 60101.5/63371: 95% mana bloodlust, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:21.154 aoe p arcane_explosion Fluffy_Pillow 56377.8/63371: 89% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:22.161 shared_cds s use_mana_gem Necrolord_Marileth 52654.1/63371: 83% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:22.161 aoe p arcane_explosion Fluffy_Pillow 58991.2/63371: 93% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:23.169 aoe p arcane_explosion Fluffy_Pillow 55268.8/63371: 87% mana bloodlust, arcane_charge(3), presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:24.176 aoe q arcane_barrage Fluffy_Pillow 51545.1/63371: 81% mana bloodlust, arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:25.183 aoe o arcane_orb Fluffy_Pillow 55356.3/63371: 87% mana bloodlust, clearcasting, presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:26.188 aoe q arcane_barrage Fluffy_Pillow 56130.0/63371: 89% mana bloodlust, arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:27.192 aoe p arcane_explosion Fluffy_Pillow 59937.4/63371: 95% mana bloodlust, clearcasting, presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:28.198 aoe p arcane_explosion Fluffy_Pillow 61212.4/63371: 97% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power
0:29.204 aoe p arcane_explosion Fluffy_Pillow 57487.5/63371: 91% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power
0:30.211 aoe p arcane_explosion Fluffy_Pillow 53763.8/63371: 85% mana bloodlust, arcane_charge(3), presence_of_mind(3), rune_of_power
0:31.218 aoe q arcane_barrage Fluffy_Pillow 50040.1/63371: 79% mana bloodlust, arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
0:32.224 aoe p arcane_explosion Fluffy_Pillow 53849.9/63371: 85% mana bloodlust, clearcasting, presence_of_mind(3), rune_of_power
0:33.231 aoe p arcane_explosion Fluffy_Pillow 55126.2/63371: 87% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power
0:34.239 aoe p arcane_explosion Fluffy_Pillow 51403.8/63371: 81% mana bloodlust, arcane_charge(2), presence_of_mind(3)
0:35.245 aoe p arcane_explosion Fluffy_Pillow 47678.8/63371: 75% mana bloodlust, arcane_charge(3), presence_of_mind(3)
0:36.252 aoe q arcane_barrage Fluffy_Pillow 43955.1/63371: 69% mana bloodlust, arcane_charge(4), clearcasting, presence_of_mind(3)
0:37.259 aoe p arcane_explosion Fluffy_Pillow 47766.3/63371: 75% mana bloodlust, clearcasting, presence_of_mind(3)
0:38.265 aoe p arcane_explosion Fluffy_Pillow 49041.3/63371: 77% mana bloodlust, arcane_charge, presence_of_mind(3)
0:39.272 aoe p arcane_explosion Fluffy_Pillow 45317.6/63371: 72% mana bloodlust, arcane_charge(2), presence_of_mind(3)
0:40.278 aoe p arcane_explosion Fluffy_Pillow 41592.7/63371: 66% mana bloodlust, arcane_charge(3), presence_of_mind(3)
0:41.285 aoe q arcane_barrage Fluffy_Pillow 37869.0/63371: 60% mana arcane_charge(4), clearcasting, presence_of_mind(3)
0:42.592 aoe p arcane_explosion Fluffy_Pillow 42060.4/63371: 66% mana clearcasting, presence_of_mind(3)
0:43.898 aoe p arcane_explosion Fluffy_Pillow 43715.6/63371: 69% mana arcane_charge, presence_of_mind(3)
0:45.203 aoe p arcane_explosion Fluffy_Pillow 40369.6/63371: 64% mana arcane_charge(2), presence_of_mind(3)
0:46.509 aoe p arcane_explosion Fluffy_Pillow 37024.9/63371: 58% mana arcane_charge(3), clearcasting, presence_of_mind(3)
0:47.816 aoe q arcane_barrage Fluffy_Pillow 38681.4/63371: 61% mana arcane_charge(4), presence_of_mind(3)
0:49.121 aoe o arcane_orb Fluffy_Pillow 42870.3/63371: 68% mana presence_of_mind(3)
0:50.427 aoe q arcane_barrage Fluffy_Pillow 44025.5/63371: 69% mana arcane_charge(4), presence_of_mind(3)
0:51.732 aoe p arcane_explosion Fluffy_Pillow 48214.4/63371: 76% mana presence_of_mind(3)
0:53.040 aoe p arcane_explosion Fluffy_Pillow 44872.2/63371: 71% mana arcane_charge, presence_of_mind(3)
0:54.345 aoe p arcane_explosion Fluffy_Pillow 41526.2/63371: 66% mana arcane_charge(2), clearcasting, presence_of_mind(3)
0:55.651 aoe p arcane_explosion Fluffy_Pillow 43181.4/63371: 68% mana arcane_charge(3), presence_of_mind(3)
0:56.957 aoe q arcane_barrage Fluffy_Pillow 39836.7/63371: 63% mana arcane_charge(4), presence_of_mind(3)
0:58.264 aoe p arcane_explosion Fluffy_Pillow 44028.1/63371: 69% mana presence_of_mind(3)
0:59.570 aoe p arcane_explosion Fluffy_Pillow 40683.3/63371: 64% mana arcane_charge, presence_of_mind(3)
1:00.876 aoe p arcane_explosion Fluffy_Pillow 37338.6/63371: 59% mana arcane_charge(2), presence_of_mind(3)
1:02.186 aoe p arcane_explosion Fluffy_Pillow 33998.9/63371: 54% mana arcane_charge(3), presence_of_mind(3)
1:03.491 aoe q arcane_barrage Fluffy_Pillow 30652.9/63371: 48% mana arcane_charge(4), presence_of_mind(3)
1:04.796 aoe k touch_of_the_magi Fluffy_Pillow 34841.8/63371: 55% mana presence_of_mind(3)
1:06.102 aoe m rune_of_power Fluffy_Pillow 33997.0/63371: 54% mana arcane_charge(4), clearcasting, presence_of_mind(3)
1:07.407 aoe q arcane_barrage Fluffy_Pillow 35651.0/63371: 56% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
1:08.713 aoe p arcane_explosion Fluffy_Pillow 39841.1/63371: 63% mana clearcasting, presence_of_mind(3), rune_of_power
1:10.021 aoe p arcane_explosion Fluffy_Pillow 41498.9/63371: 65% mana arcane_charge, presence_of_mind(3), rune_of_power
1:11.327 aoe p arcane_explosion Fluffy_Pillow 38154.2/63371: 60% mana arcane_charge(2), presence_of_mind(3), rune_of_power
1:12.633 aoe p arcane_explosion Fluffy_Pillow 34809.5/63371: 55% mana arcane_charge(3), presence_of_mind(3), rune_of_power
1:13.939 aoe q arcane_barrage Fluffy_Pillow 31464.7/63371: 50% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:15.245 aoe o arcane_orb Fluffy_Pillow 35654.8/63371: 56% mana presence_of_mind(3), rune_of_power
1:16.548 aoe q arcane_barrage Fluffy_Pillow 36806.3/63371: 58% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:17.854 aoe p arcane_explosion Fluffy_Pillow 40996.4/63371: 65% mana presence_of_mind(3), rune_of_power
1:19.159 aoe p arcane_explosion Fluffy_Pillow 37650.4/63371: 59% mana arcane_charge, presence_of_mind(3), rune_of_power
1:20.465 aoe p arcane_explosion Fluffy_Pillow 34305.7/63371: 54% mana arcane_charge(2), presence_of_mind(3), rune_of_power
1:21.771 aoe p arcane_explosion Fluffy_Pillow 30960.9/63371: 49% mana arcane_charge(3), presence_of_mind(3), rune_of_power
1:23.077 aoe q arcane_barrage Fluffy_Pillow 27616.2/63371: 44% mana arcane_charge(4), presence_of_mind(3)
1:24.385 aoe p arcane_explosion Fluffy_Pillow 31808.9/63371: 50% mana presence_of_mind(3)
1:25.690 aoe p arcane_explosion Fluffy_Pillow 28462.9/63371: 45% mana arcane_charge, presence_of_mind(3)
1:26.997 aoe p arcane_explosion Fluffy_Pillow 25119.4/63371: 40% mana arcane_charge(2), clearcasting, presence_of_mind(3)
1:28.305 aoe p arcane_explosion Fluffy_Pillow 26777.2/63371: 42% mana arcane_charge(3), presence_of_mind(3)
1:29.614 aoe q arcane_barrage Fluffy_Pillow 23436.2/63371: 37% mana arcane_charge(4), presence_of_mind(3)
1:30.920 aoe p arcane_explosion Fluffy_Pillow 27626.4/63371: 44% mana presence_of_mind(3)
1:32.226 aoe p arcane_explosion Fluffy_Pillow 24281.6/63371: 38% mana arcane_charge, presence_of_mind(3)
1:33.532 aoe p arcane_explosion Fluffy_Pillow 20936.9/63371: 33% mana arcane_charge(2), presence_of_mind(3)
1:34.839 aoe p arcane_explosion Fluffy_Pillow 17593.4/63371: 28% mana arcane_charge(3), presence_of_mind(3)
1:36.145 aoe q arcane_barrage Fluffy_Pillow 14248.7/63371: 22% mana arcane_charge(4), presence_of_mind(3)
1:37.451 aoe o arcane_orb Fluffy_Pillow 18438.8/63371: 29% mana presence_of_mind(3)
1:38.759 aoe q arcane_barrage Fluffy_Pillow 19596.6/63371: 31% mana arcane_charge(4), presence_of_mind(3)
1:40.066 aoe p arcane_explosion Fluffy_Pillow 23788.0/63371: 38% mana presence_of_mind(3)
1:41.373 aoe p arcane_explosion Fluffy_Pillow 20444.5/63371: 32% mana arcane_charge, presence_of_mind(3)
1:42.680 aoe p arcane_explosion Fluffy_Pillow 17101.0/63371: 27% mana arcane_charge(2), clearcasting, presence_of_mind(3)
1:43.987 aoe p arcane_explosion Fluffy_Pillow 18757.6/63371: 30% mana arcane_charge(3), presence_of_mind(3)
1:45.294 aoe q arcane_barrage Fluffy_Pillow 15414.1/63371: 24% mana arcane_charge(4), clearcasting, presence_of_mind(3)
1:46.601 aoe p arcane_explosion Fluffy_Pillow 19605.5/63371: 31% mana clearcasting, presence_of_mind(3)
1:47.909 aoe p arcane_explosion Fluffy_Pillow 21263.3/63371: 34% mana arcane_charge, presence_of_mind(3)
1:49.215 aoe p arcane_explosion Fluffy_Pillow 17918.5/63371: 28% mana arcane_charge(2), presence_of_mind(3)
1:50.522 aoe p arcane_explosion Fluffy_Pillow 14575.1/63371: 23% mana arcane_charge(3), presence_of_mind(3)
1:51.830 aoe q arcane_barrage Fluffy_Pillow 11232.9/63371: 18% mana arcane_charge(4), presence_of_mind(3)
1:53.137 aoe k touch_of_the_magi Fluffy_Pillow 15424.3/63371: 24% mana presence_of_mind(3)
1:54.444 aoe m rune_of_power Fluffy_Pillow 14580.8/63371: 23% mana arcane_charge(4), presence_of_mind(3)
1:55.751 aoe q arcane_barrage Fluffy_Pillow 16237.3/63371: 26% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:57.058 aoe p arcane_explosion Fluffy_Pillow 20428.7/63371: 32% mana presence_of_mind(3), rune_of_power
1:58.365 aoe p arcane_explosion Fluffy_Pillow 17085.2/63371: 27% mana arcane_charge, presence_of_mind(3), rune_of_power
1:59.671 aoe p arcane_explosion Fluffy_Pillow 13740.5/63371: 22% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:00.977 aoe p arcane_explosion Fluffy_Pillow 10395.7/63371: 16% mana arcane_charge(3), clearcasting, presence_of_mind(3), rune_of_power
2:02.282 aoe q arcane_barrage Fluffy_Pillow 12049.7/63371: 19% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:03.589 aoe o arcane_orb Fluffy_Pillow 16241.1/63371: 26% mana presence_of_mind(3), rune_of_power
2:04.895 aoe q arcane_barrage Fluffy_Pillow 17396.4/63371: 27% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
2:06.203 aoe p arcane_explosion Fluffy_Pillow 21589.0/63371: 34% mana clearcasting, presence_of_mind(3), rune_of_power
2:07.509 aoe p arcane_explosion Fluffy_Pillow 23244.3/63371: 37% mana arcane_charge, presence_of_mind(3), rune_of_power
2:08.816 aoe p arcane_explosion Fluffy_Pillow 19900.8/63371: 31% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:10.121 aoe p arcane_explosion Fluffy_Pillow 16554.8/63371: 26% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:11.427 aoe l arcane_power Fluffy_Pillow 13210.1/63371: 21% mana arcane_charge(4), presence_of_mind(3)
2:11.427 aoe q arcane_barrage Fluffy_Pillow 13210.1/63371: 21% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:12.735 aoe p arcane_explosion Fluffy_Pillow 17402.7/63371: 27% mana arcane_power, presence_of_mind(3), rune_of_power
2:14.040 aoe p arcane_explosion Fluffy_Pillow 16556.7/63371: 26% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:15.347 aoe p arcane_explosion Fluffy_Pillow 15713.3/63371: 25% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power
2:16.653 aoe p arcane_explosion Fluffy_Pillow 14868.5/63371: 23% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:17.960 aoe q arcane_barrage Fluffy_Pillow 14025.1/63371: 22% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:19.266 aoe p arcane_explosion Fluffy_Pillow 18215.2/63371: 29% mana arcane_power, presence_of_mind(3), rune_of_power
2:20.572 aoe p arcane_explosion Fluffy_Pillow 17370.4/63371: 27% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:21.879 aoe p arcane_explosion Fluffy_Pillow 16527.0/63371: 26% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power
2:23.186 shared_cds s use_mana_gem Necrolord_Marileth 15683.5/63371: 25% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:23.186 aoe p arcane_explosion Fluffy_Pillow 22020.6/63371: 35% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:24.494 aoe q arcane_barrage Fluffy_Pillow 21178.4/63371: 33% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:25.800 aoe o arcane_orb Fluffy_Pillow 25368.6/63371: 40% mana arcane_power, presence_of_mind(3), rune_of_power
2:27.108 aoe q arcane_barrage Fluffy_Pillow 26776.4/63371: 42% mana arcane_charge(4), presence_of_mind(3)
2:28.416 aoe p arcane_explosion Fluffy_Pillow 30969.0/63371: 49% mana presence_of_mind(3)
2:29.723 aoe p arcane_explosion Fluffy_Pillow 27625.5/63371: 44% mana arcane_charge, clearcasting, presence_of_mind(3)
2:31.028 aoe p arcane_explosion Fluffy_Pillow 29279.5/63371: 46% mana arcane_charge(2), presence_of_mind(3)
2:32.335 aoe p arcane_explosion Fluffy_Pillow 25936.1/63371: 41% mana arcane_charge(3), presence_of_mind(3)
2:33.642 aoe q arcane_barrage Fluffy_Pillow 22592.6/63371: 36% mana arcane_charge(4), presence_of_mind(3)
2:34.947 aoe p arcane_explosion Fluffy_Pillow 26781.4/63371: 42% mana presence_of_mind(3)
2:36.253 aoe p arcane_explosion Fluffy_Pillow 23436.7/63371: 37% mana arcane_charge, presence_of_mind(3)
2:37.560 aoe p arcane_explosion Fluffy_Pillow 20093.2/63371: 32% mana arcane_charge(2), presence_of_mind(3)
2:38.865 aoe p arcane_explosion Fluffy_Pillow 16747.2/63371: 26% mana arcane_charge(3), presence_of_mind(3)
2:40.173 aoe q arcane_barrage Fluffy_Pillow 13405.0/63371: 21% mana arcane_charge(4), presence_of_mind(3)
2:41.479 aoe k touch_of_the_magi Fluffy_Pillow 17595.1/63371: 28% mana presence_of_mind(3)
2:42.788 aoe m rune_of_power Fluffy_Pillow 16754.2/63371: 26% mana arcane_charge(4), presence_of_mind(3)
2:44.094 aoe q arcane_barrage Fluffy_Pillow 18409.5/63371: 29% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:45.399 aoe p arcane_explosion Fluffy_Pillow 22598.3/63371: 36% mana presence_of_mind(3), rune_of_power
2:46.706 aoe p arcane_explosion Fluffy_Pillow 19254.8/63371: 30% mana arcane_charge, clearcasting, presence_of_mind(3), rune_of_power
2:48.010 aoe p arcane_explosion Fluffy_Pillow 20907.6/63371: 33% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:49.317 aoe p arcane_explosion Fluffy_Pillow 17564.1/63371: 28% mana arcane_charge(3), clearcasting, presence_of_mind(3), rune_of_power
2:50.625 aoe q arcane_barrage Fluffy_Pillow 19221.9/63371: 30% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:51.931 aoe o arcane_orb Fluffy_Pillow 23412.0/63371: 37% mana presence_of_mind(3), rune_of_power
2:53.238 aoe q arcane_barrage Fluffy_Pillow 24568.5/63371: 39% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:54.544 aoe p arcane_explosion Fluffy_Pillow 28758.7/63371: 45% mana presence_of_mind(3), rune_of_power
2:55.849 aoe p arcane_explosion Fluffy_Pillow 25412.7/63371: 40% mana arcane_charge, presence_of_mind(3), rune_of_power
2:57.154 aoe p arcane_explosion Fluffy_Pillow 22066.7/63371: 35% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:58.460 aoe p arcane_explosion Fluffy_Pillow 18721.9/63371: 30% mana arcane_charge(3), clearcasting, presence_of_mind(3), rune_of_power
2:59.766 aoe q arcane_barrage Fluffy_Pillow 20377.2/63371: 32% mana arcane_charge(4), presence_of_mind(3)
3:01.073 aoe p arcane_explosion Fluffy_Pillow 24568.6/63371: 39% mana presence_of_mind(3)
3:02.379 aoe p arcane_explosion Fluffy_Pillow 21223.8/63371: 33% mana arcane_charge, presence_of_mind(3)
3:03.685 aoe p arcane_explosion Fluffy_Pillow 17879.1/63371: 28% mana arcane_charge(2), presence_of_mind(3)
3:04.992 aoe p arcane_explosion Fluffy_Pillow 14535.6/63371: 23% mana arcane_charge(3), presence_of_mind(3)
3:06.300 aoe q arcane_barrage Fluffy_Pillow 11193.4/63371: 18% mana arcane_charge(4), presence_of_mind(3)
3:07.608 aoe p arcane_explosion Fluffy_Pillow 15386.1/63371: 24% mana presence_of_mind(3)
3:08.914 aoe p arcane_explosion Fluffy_Pillow 12041.3/63371: 19% mana arcane_charge, presence_of_mind(3)
3:10.222 aoe p arcane_explosion Fluffy_Pillow 8699.1/63371: 14% mana arcane_charge(2), clearcasting, presence_of_mind(3)
3:11.527 aoe p arcane_explosion Fluffy_Pillow 10353.1/63371: 16% mana arcane_charge(3), presence_of_mind(3)
3:12.833 aoe q arcane_barrage Fluffy_Pillow 7008.4/63371: 11% mana arcane_charge(4), presence_of_mind(3)
3:14.139 aoe o arcane_orb Fluffy_Pillow 11198.5/63371: 18% mana presence_of_mind(3)
3:15.445 aoe q arcane_barrage Fluffy_Pillow 12353.8/63371: 19% mana arcane_charge(4), presence_of_mind(3)
3:16.751 aoe p arcane_explosion Fluffy_Pillow 16543.9/63371: 26% mana presence_of_mind(3)
3:18.056 aoe p arcane_explosion Fluffy_Pillow 13197.9/63371: 21% mana arcane_charge, presence_of_mind(3)
3:19.361 aoe p arcane_explosion Fluffy_Pillow 9851.9/63371: 16% mana arcane_charge(2), presence_of_mind(3)
3:20.667 aoe p arcane_explosion Fluffy_Pillow 6507.1/63371: 10% mana arcane_charge(3), presence_of_mind(3)
3:21.971 aoe q arcane_barrage Fluffy_Pillow 3159.9/63371: 5% mana arcane_charge(4), presence_of_mind(3)
3:23.278 aoe p arcane_explosion Fluffy_Pillow 7351.2/63371: 12% mana presence_of_mind(3)
3:24.582 aoe r evocation Necrolord_Marileth 4004.0/63371: 6% mana arcane_charge, presence_of_mind(3)
3:28.927 aoe k touch_of_the_magi Fluffy_Pillow 57849.9/63371: 91% mana arcane_charge, presence_of_mind(3)
3:30.234 aoe m rune_of_power Fluffy_Pillow 57006.4/63371: 90% mana arcane_charge(4), presence_of_mind(3)
3:31.540 aoe q arcane_barrage Fluffy_Pillow 58661.7/63371: 93% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:32.847 aoe p arcane_explosion Fluffy_Pillow 62853.1/63371: 99% mana presence_of_mind(3), rune_of_power
3:34.154 aoe p arcane_explosion Fluffy_Pillow 59509.6/63371: 94% mana arcane_charge, clearcasting, presence_of_mind(3), rune_of_power
3:35.458 aoe p arcane_explosion Fluffy_Pillow 61162.3/63371: 97% mana arcane_charge(2), presence_of_mind(3), rune_of_power
3:36.763 aoe p arcane_explosion Fluffy_Pillow 57816.3/63371: 91% mana arcane_charge(3), presence_of_mind(3), rune_of_power
3:38.069 aoe q arcane_barrage Fluffy_Pillow 54471.6/63371: 86% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:39.376 aoe o arcane_orb Fluffy_Pillow 58663.0/63371: 93% mana presence_of_mind(3), rune_of_power
3:40.683 aoe q arcane_barrage Fluffy_Pillow 59819.5/63371: 94% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:41.988 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana presence_of_mind(3), rune_of_power
3:43.293 aoe p arcane_explosion Fluffy_Pillow 60025.4/63371: 95% mana arcane_charge, presence_of_mind(3), rune_of_power
3:44.600 aoe p arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), presence_of_mind(3), rune_of_power
3:45.907 aoe p arcane_explosion Fluffy_Pillow 53338.5/63371: 84% mana arcane_charge(3), presence_of_mind(3), rune_of_power
3:47.214 aoe q arcane_barrage Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4), clearcasting, presence_of_mind(3)
3:48.520 aoe p arcane_explosion Fluffy_Pillow 54185.1/63371: 86% mana clearcasting, presence_of_mind(3)
3:49.828 aoe p arcane_explosion Fluffy_Pillow 55842.9/63371: 88% mana arcane_charge, presence_of_mind(3)
3:51.133 aoe p arcane_explosion Fluffy_Pillow 52496.9/63371: 83% mana arcane_charge(2), clearcasting, presence_of_mind(3)
3:52.439 aoe p arcane_explosion Fluffy_Pillow 54152.2/63371: 85% mana arcane_charge(3), presence_of_mind(3)
3:53.744 aoe q arcane_barrage Fluffy_Pillow 50806.2/63371: 80% mana arcane_charge(4), presence_of_mind(3)
3:55.052 aoe p arcane_explosion Fluffy_Pillow 54998.8/63371: 87% mana presence_of_mind(3)
3:56.357 aoe p arcane_explosion Fluffy_Pillow 51652.8/63371: 82% mana arcane_charge, presence_of_mind(3)
3:57.664 aoe p arcane_explosion Fluffy_Pillow 48309.4/63371: 76% mana arcane_charge(2), presence_of_mind(3)
3:58.970 aoe p arcane_explosion Fluffy_Pillow 44964.6/63371: 71% mana arcane_charge(3), presence_of_mind(3)
4:00.276 aoe q arcane_barrage Fluffy_Pillow 41619.9/63371: 66% mana arcane_charge(4), presence_of_mind(3)
4:01.583 aoe o arcane_orb Fluffy_Pillow 45811.3/63371: 72% mana presence_of_mind(3)
4:02.889 aoe q arcane_barrage Fluffy_Pillow 46966.5/63371: 74% mana arcane_charge(4), presence_of_mind(3)
4:04.195 aoe p arcane_explosion Fluffy_Pillow 51156.6/63371: 81% mana presence_of_mind(3)
4:05.503 aoe p arcane_explosion Fluffy_Pillow 47814.4/63371: 75% mana arcane_charge, presence_of_mind(3)
4:06.808 aoe p arcane_explosion Fluffy_Pillow 44468.4/63371: 70% mana arcane_charge(2), presence_of_mind(3)
4:08.115 aoe p arcane_explosion Fluffy_Pillow 41125.0/63371: 65% mana arcane_charge(3), presence_of_mind(3)
4:09.423 aoe q arcane_barrage Fluffy_Pillow 37782.8/63371: 60% mana arcane_charge(4), presence_of_mind(3)
4:10.729 aoe p arcane_explosion Fluffy_Pillow 41972.9/63371: 66% mana presence_of_mind(3)
4:12.034 aoe p arcane_explosion Fluffy_Pillow 38626.9/63371: 61% mana arcane_charge, presence_of_mind(3)
4:13.340 aoe p arcane_explosion Fluffy_Pillow 35282.1/63371: 56% mana arcane_charge(2), presence_of_mind(3)
4:14.647 aoe p arcane_explosion Fluffy_Pillow 31938.7/63371: 50% mana arcane_charge(3), presence_of_mind(3)
4:15.953 aoe q arcane_barrage Fluffy_Pillow 28593.9/63371: 45% mana arcane_charge(4), presence_of_mind(3)
4:17.259 aoe j deathborne Fluffy_Pillow 32784.0/63371: 52% mana presence_of_mind(3)
4:18.566 aoe k touch_of_the_magi Fluffy_Pillow 31940.6/63371: 50% mana presence_of_mind(3), deathborne
4:19.871 aoe l arcane_power Fluffy_Pillow 31094.6/63371: 49% mana arcane_charge(4), presence_of_mind(3), deathborne
4:19.871 shared_cds u berserking Fluffy_Pillow 31094.6/63371: 49% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:19.871 aoe q arcane_barrage Fluffy_Pillow 31094.6/63371: 49% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:21.060 aoe p arcane_explosion Fluffy_Pillow 35136.4/63371: 55% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:22.248 aoe p arcane_explosion Fluffy_Pillow 34142.1/63371: 54% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:23.436 shared_cds s use_mana_gem Necrolord_Marileth 33147.8/63371: 52% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:23.436 aoe p arcane_explosion Fluffy_Pillow 39485.0/63371: 62% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:24.625 aoe p arcane_explosion Fluffy_Pillow 38491.9/63371: 61% mana berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:25.815 aoe q arcane_barrage Fluffy_Pillow 37500.2/63371: 59% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:27.003 aoe o arcane_orb Fluffy_Pillow 41540.7/63371: 66% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:28.191 aoe q arcane_barrage Fluffy_Pillow 42796.4/63371: 68% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:29.379 aoe p arcane_explosion Fluffy_Pillow 46837.0/63371: 74% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:30.567 aoe p arcane_explosion Fluffy_Pillow 45842.7/63371: 72% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Marileth"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream : 17391 dps, 4729 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17390.9 17390.9 22.6 / 0.130% 1419.7 / 8.2% 9.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
1890.2 1788.3 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 17391
Arcane Barrage 5836 33.5% 54.0 5.55sec 32225 26038 Direct 269.8 5412 10808 6457 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.03 269.78 0.00 0.00 1.2376 0.0000 1741202.68 1741202.68 0.00% 26037.84 26037.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 217.54 164 271 5411.75 2082 25140 5414.92 4970 5839 1177079 1177079 0.00%
crit 19.36% 52.23 31 80 10807.96 4164 50280 10809.16 7948 14892 564123 564123 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.04
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 482 2.8% 41.2 6.91sec 3494 0 Direct 206.1 586 1174 699 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.21 206.07 0.00 0.00 0.0000 0.0000 143999.84 143999.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 166.39 116 215 585.55 443 664 585.55 563 606 97425 97425 0.00%
crit 19.26% 39.68 23 60 1173.94 886 1329 1173.65 1050 1293 46574 46574 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7761 44.6% 142.0 2.08sec 16324 13129 Direct 710.1 2735 5475 3264 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.01 710.05 0.00 0.00 1.2433 0.0000 2318168.29 2318168.29 0.00% 13129.19 13129.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 572.84 451 702 2735.23 1958 4112 2735.16 2637 2820 1566931 1566931 0.00%
crit 19.33% 137.22 87 189 5475.04 3916 8223 5473.76 5015 5850 751237 751237 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.00
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1474) 0.0% (8.5%) 13.8 22.28sec 31855 25807

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.80 0.00 0.00 0.00 1.2344 0.0000 0.00 0.00 0.00% 25806.81 25806.81

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.80
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1474 8.5% 68.9 22.28sec 6378 0 Direct 68.9 5337 10715 6377 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.92 68.92 0.00 0.00 0.0000 0.0000 439619.07 439619.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 55.61 39 76 5337.31 3869 8126 5346.78 4857 5795 296792 296792 0.00%
crit 19.32% 13.32 3 28 10714.81 7739 16251 10743.44 8083 13697 142827 142827 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (84) 0.0% (0.5%) 18.4 8.80sec 1392 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.35 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 84 0.5% 18.4 8.80sec 1392 0 Direct 18.4 1164 2327 1392 19.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.35 18.35 0.00 0.00 0.0000 0.0000 25547.40 25547.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.36% 14.75 4 30 1163.53 1164 1164 1163.53 1164 1164 17160 17160 0.00%
crit 19.64% 3.60 0 11 2327.06 2327 2327 2253.91 0 2327 8387 8387 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1751 18.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1748.30 1748.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.93% 0.82 0 1 1480.68 1481 1481 1213.05 0 1481 1213 1213 0.00%
crit 18.07% 0.18 0 1 2961.35 2961 2961 535.25 0 2961 535 535 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.1%) 1.0 0.00sec 6045 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 21 0.1% 90.0 1.29sec 67 51 Direct 90.0 56 113 67 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6044.60 6044.60 0.00% 51.32 51.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 72.51 60 85 56.21 43 60 56.21 55 57 4076 4076 0.00%
crit 19.43% 17.49 5 30 112.59 86 120 112.59 102 120 1969 1969 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 643 3.7% 5.9 49.52sec 32548 9128 Periodic 117.4 1372 2745 1638 19.3% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.91 0.00 23.48 117.42 3.5656 0.8339 192317.00 192317.00 0.00% 9128.39 9128.39
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.65% 94.70 69 126 1372.31 1372 1372 1372.31 1372 1372 129959 129959 0.00%
crit 19.35% 22.72 9 40 2744.61 2745 2745 2744.61 2745 2745 62358 62358 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.91
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1084) 0.0% (6.2%) 6.6 49.18sec 49349 37773

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.56 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 37773.35 37773.35

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.59
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1084 6.2% 6.6 49.02sec 49349 0 Direct 32.6 9935 0 9935 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.56 32.60 0.00 0.00 0.0000 0.0000 323528.70 323528.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.60 25 40 9935.05 2616 47407 9942.84 8185 13096 323529 323529 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6931.55
  • base_dd_max:6931.55
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream
Arcane Power 3.5 97.24sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.66sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.3 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.28 0.00 1.64 0.00 4.2918 0.7219 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.28
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.51sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.46
  • if_expr:buff.arcane_power.up
Rune of Power 6.3 47.95sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.34 0.00 0.00 0.00 1.2592 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.38
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.80sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.79
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 54.8 176.5 5.5sec 1.3sec 4.2sec 76.31% 0.00% 31.0 (32.9) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.1s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:21.33%
  • arcane_charge_2:18.91%
  • arcane_charge_3:14.51%
  • arcane_charge_4:21.56%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.5 0.0 97.2sec 97.2sec 14.7sec 17.45% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.4s
  • trigger_min/max:96.0s / 102.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.45%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.14% 23.70% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.8s / 199.2s
  • trigger_min/max:192.8s / 199.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.14%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.1 0.2 13.0sec 12.9sec 2.2sec 16.31% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.10%
  • clearcasting_2:0.22%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.3 0.0 0.0sec 0.0sec 4.3sec 0.39% 0.00% 1.1 (1.1) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:0.41%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.3sec 11.18% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.1s
  • trigger_min/max:300.0s / 301.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.18%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.9 0.0 31.5sec 31.5sec 14.6sec 48.41% 0.00% 0.0 (0.0) 9.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.7s
  • trigger_min/max:16.8s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.41%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.62% 0.76% 5.34% 0.9s 0.0s 3.9s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000202.911144.053263.917
Evocation222.112127.125353.925283.309171.366359.855
Rune of Power14.2090.00757.50093.47076.582110.991
Touch of the Magi10.8950.00016.86173.73053.53093.053
Arcane Power1.2490.0046.3564.4352.1168.905
Arcane Barrage3.0400.00012.214165.558132.497202.355
Arcane Orb4.6050.00013.28764.11348.78482.807
Shifting Power9.3890.00037.65955.58450.27579.186

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
mana_regen Mana 683.34 371121.01 69.40% 543.10 7203.36 1.90%
Evocation Mana 13.25 13333.62 2.49% 1006.57 0.00 0.00%
Mana Gem Mana 2.79 17663.10 3.30% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.04 132620.41 24.80% 2454.13 4362.39 3.18%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1788.34 1890.17 11558.0 32935.5 1212.9 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream
arcane_explosion Mana 142.0 526677.9 3709.0 3708.7 4.4
arcane_orb Mana 13.8 6147.0 445.4 445.4 71.5
shifting_power Mana 5.9 14775.1 2500.0 2500.6 13.0
touch_of_the_magi Mana 6.6 16407.2 2500.0 2502.6 19.7

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
NightFae_Dream Damage Per Second
Count 1018
Mean 17390.86
Minimum 16316.39
Maximum 18694.68
Spread ( max - min ) 2378.29
Range [ ( max - min ) / 2 * 100% ] 6.84%
Standard Deviation 367.2963
5th Percentile 16789.15
95th Percentile 18018.00
( 95th Percentile - 5th Percentile ) 1228.85
Mean Distribution
Standard Deviation 11.5118
95.00% Confidence Interval ( 17368.30 - 17413.43 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1714
0.1 Scale Factor Error with Delta=300 1152
0.05 Scale Factor Error with Delta=300 4607
0.01 Scale Factor Error with Delta=300 115164
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 1018
Mean 4729.06
Minimum 4268.11
Maximum 5329.98
Spread ( max - min ) 1061.87
Range [ ( max - min ) / 2 * 100% ] 11.23%
Standard Deviation 170.3557
5th Percentile 4467.08
95th Percentile 5032.55
( 95th Percentile - 5th Percentile ) 565.47
Mean Distribution
Standard Deviation 5.3393
95.00% Confidence Interval ( 4718.60 - 4739.53 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4985
0.1 Scale Factor Error with Delta=300 248
0.05 Scale Factor Error with Delta=300 991
0.01 Scale Factor Error with Delta=300 24775
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 1018
Mean 17390.86
Minimum 16316.39
Maximum 18694.68
Spread ( max - min ) 2378.29
Range [ ( max - min ) / 2 * 100% ] 6.84%
Damage
NightFae_Dream Damage
Count 1018
Mean 5186131.28
Minimum 4144907.51
Maximum 6263869.80
Spread ( max - min ) 2118962.29
Range [ ( max - min ) / 2 * 100% ] 20.43%
DTPS
NightFae_Dream Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.59 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.38 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.80 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.91 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.00 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.04 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.28 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.79 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.46 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmporooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpoooopooroopmpo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4)
0:01.307 shared_cds s potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.307 shared_cds t berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.307 aoe p arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.221 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.133 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.048 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.963 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.878 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.792 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.705 aoe p arcane_barrage Fluffy_Pillow 58006.4/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.619 aoe o arcane_explosion Fluffy_Pillow 61699.7/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.534 aoe o arcane_explosion Fluffy_Pillow 60359.4/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.448 aoe o arcane_explosion Fluffy_Pillow 59017.8/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.362 aoe o arcane_explosion Fluffy_Pillow 57676.3/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.275 aoe p arcane_barrage Fluffy_Pillow 56333.4/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.191 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.105 aoe o arcane_explosion Fluffy_Pillow 58687.7/63371: 93% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.113 aoe o arcane_explosion Fluffy_Pillow 57465.2/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.120 aoe o arcane_explosion Fluffy_Pillow 56241.5/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.128 aoe l rune_of_power Fluffy_Pillow 55019.1/63371: 87% mana bloodlust, arcane_charge(4), clearcasting, potion_of_deathly_fixation
0:18.134 aoe p arcane_barrage Fluffy_Pillow 56294.1/63371: 89% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:19.142 aoe o arcane_explosion Fluffy_Pillow 60106.6/63371: 95% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:20.150 aoe o arcane_explosion Fluffy_Pillow 61384.1/63371: 97% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.155 aoe o arcane_explosion Fluffy_Pillow 57657.9/63371: 91% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.161 aoe o arcane_explosion Fluffy_Pillow 53932.9/63371: 85% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.168 shared_cds r use_mana_gem NightFae_Dream 50209.2/63371: 79% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:23.168 aoe p arcane_barrage Fluffy_Pillow 56546.4/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.175 aoe m arcane_orb Fluffy_Pillow 60357.5/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.182 aoe p arcane_barrage Fluffy_Pillow 61133.8/63371: 96% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.189 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.198 aoe o arcane_explosion Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.205 aoe o arcane_explosion Fluffy_Pillow 55926.6/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:29.213 aoe o arcane_explosion Fluffy_Pillow 57204.1/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power
0:30.219 aoe p arcane_barrage Fluffy_Pillow 53479.2/63371: 84% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power
0:31.226 aoe o arcane_explosion Fluffy_Pillow 57290.3/63371: 90% mana bloodlust, clearcasting, rune_of_power
0:32.233 aoe o arcane_explosion Fluffy_Pillow 58566.6/63371: 92% mana bloodlust, arcane_charge, rune_of_power
0:33.239 aoe n shifting_power Fluffy_Pillow 54841.7/63371: 87% mana bloodlust, arcane_charge(2)
0:36.130 aoe o arcane_explosion Fluffy_Pillow 56005.8/63371: 88% mana bloodlust, arcane_charge(2)
0:37.136 aoe o arcane_explosion Fluffy_Pillow 52280.8/63371: 82% mana bloodlust, arcane_charge(3)
0:38.141 aoe p arcane_barrage Fluffy_Pillow 48554.6/63371: 77% mana bloodlust, arcane_charge(4)
0:39.146 aoe m arcane_orb Fluffy_Pillow 52363.2/63371: 83% mana bloodlust
0:40.152 aoe p arcane_barrage Fluffy_Pillow 53138.2/63371: 84% mana bloodlust, arcane_charge(4)
0:41.159 aoe o arcane_explosion Fluffy_Pillow 56949.4/63371: 90% mana
0:42.466 aoe o arcane_explosion Fluffy_Pillow 53605.9/63371: 85% mana arcane_charge, clearcasting
0:43.773 aoe o arcane_explosion Fluffy_Pillow 55262.5/63371: 87% mana arcane_charge(2)
0:45.078 aoe o arcane_explosion Fluffy_Pillow 51916.5/63371: 82% mana arcane_charge(3)
0:46.385 aoe p arcane_barrage Fluffy_Pillow 48573.0/63371: 77% mana arcane_charge(4)
0:47.692 aoe o arcane_explosion Fluffy_Pillow 52764.4/63371: 83% mana
0:48.997 aoe o arcane_explosion Fluffy_Pillow 49418.4/63371: 78% mana arcane_charge
0:50.302 aoe j touch_of_the_magi Fluffy_Pillow 46072.4/63371: 73% mana arcane_charge(2)
0:51.610 aoe l rune_of_power Fluffy_Pillow 45230.2/63371: 71% mana arcane_charge(4)
0:52.917 aoe p arcane_barrage Fluffy_Pillow 46886.7/63371: 74% mana arcane_charge(4), rune_of_power
0:54.225 aoe o arcane_explosion Fluffy_Pillow 51079.3/63371: 81% mana rune_of_power
0:55.531 aoe o arcane_explosion Fluffy_Pillow 47734.6/63371: 75% mana arcane_charge, rune_of_power
0:56.838 aoe o arcane_explosion Fluffy_Pillow 44391.1/63371: 70% mana arcane_charge(2), rune_of_power
0:58.144 aoe o arcane_explosion Fluffy_Pillow 41046.4/63371: 65% mana arcane_charge(3), rune_of_power
0:59.448 aoe p arcane_barrage Fluffy_Pillow 37699.1/63371: 59% mana arcane_charge(4), rune_of_power
1:00.753 aoe m arcane_orb Fluffy_Pillow 41888.0/63371: 66% mana rune_of_power
1:02.060 aoe p arcane_barrage Fluffy_Pillow 43044.5/63371: 68% mana arcane_charge(4), rune_of_power
1:03.364 aoe o arcane_explosion Fluffy_Pillow 47232.1/63371: 75% mana rune_of_power
1:04.672 aoe o arcane_explosion Fluffy_Pillow 43889.9/63371: 69% mana arcane_charge, clearcasting, rune_of_power
1:05.977 aoe o arcane_explosion Fluffy_Pillow 45543.9/63371: 72% mana arcane_charge(2), rune_of_power
1:07.284 aoe o arcane_explosion Fluffy_Pillow 42200.4/63371: 67% mana arcane_charge(3), rune_of_power
1:08.590 aoe p arcane_barrage Fluffy_Pillow 38855.7/63371: 61% mana arcane_charge(4)
1:09.897 aoe o arcane_explosion Fluffy_Pillow 43047.1/63371: 68% mana
1:11.204 aoe o arcane_explosion Fluffy_Pillow 39703.6/63371: 63% mana arcane_charge, clearcasting
1:12.510 aoe o arcane_explosion Fluffy_Pillow 41358.8/63371: 65% mana arcane_charge(2)
1:13.815 aoe o arcane_explosion Fluffy_Pillow 38012.8/63371: 60% mana arcane_charge(3)
1:15.124 aoe p arcane_barrage Fluffy_Pillow 34671.9/63371: 55% mana arcane_charge(4), clearcasting
1:16.429 aoe o arcane_explosion Fluffy_Pillow 38860.8/63371: 61% mana clearcasting
1:17.735 aoe o arcane_explosion Fluffy_Pillow 40516.0/63371: 64% mana arcane_charge
1:19.043 aoe n shifting_power Fluffy_Pillow 37173.8/63371: 59% mana arcane_charge(2)
1:22.763 aoe o arcane_explosion Fluffy_Pillow 39388.6/63371: 62% mana arcane_charge(2)
1:24.068 aoe o arcane_explosion Fluffy_Pillow 36042.6/63371: 57% mana arcane_charge(3)
1:25.375 aoe p arcane_barrage Fluffy_Pillow 32699.2/63371: 52% mana arcane_charge(4), clearcasting
1:26.679 aoe m arcane_orb Fluffy_Pillow 36886.8/63371: 58% mana clearcasting
1:27.985 aoe p arcane_barrage Fluffy_Pillow 38042.0/63371: 60% mana arcane_charge(4), clearcasting
1:29.294 aoe o arcane_explosion Fluffy_Pillow 42235.9/63371: 67% mana clearcasting
1:30.600 aoe o arcane_explosion Fluffy_Pillow 43891.2/63371: 69% mana arcane_charge
1:31.906 aoe o arcane_explosion Fluffy_Pillow 40546.5/63371: 64% mana arcane_charge(2), clearcasting
1:33.212 aoe o arcane_explosion Fluffy_Pillow 42201.7/63371: 67% mana arcane_charge(3)
1:34.520 aoe p arcane_barrage Fluffy_Pillow 38859.5/63371: 61% mana arcane_charge(4)
1:35.827 aoe o arcane_explosion Fluffy_Pillow 43050.9/63371: 68% mana
1:37.132 aoe j touch_of_the_magi Fluffy_Pillow 39704.9/63371: 63% mana arcane_charge, clearcasting
1:38.438 aoe k arcane_power Fluffy_Pillow 38860.2/63371: 61% mana arcane_charge(4), clearcasting
1:38.438 aoe p arcane_barrage Fluffy_Pillow 38860.2/63371: 61% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
1:39.745 aoe o arcane_explosion Fluffy_Pillow 43051.5/63371: 68% mana arcane_power, clearcasting, rune_of_power
1:41.052 aoe o arcane_explosion Fluffy_Pillow 44708.1/63371: 71% mana arcane_charge, arcane_power, rune_of_power
1:42.359 aoe o arcane_explosion Fluffy_Pillow 43864.6/63371: 69% mana arcane_charge(2), arcane_power, rune_of_power
1:43.667 aoe o arcane_explosion Fluffy_Pillow 43022.4/63371: 68% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power
1:44.974 aoe p arcane_barrage Fluffy_Pillow 44678.9/63371: 71% mana arcane_charge(4), arcane_power, rune_of_power
1:46.280 aoe o arcane_explosion Fluffy_Pillow 48869.1/63371: 77% mana arcane_power, rune_of_power
1:47.585 aoe o arcane_explosion Fluffy_Pillow 48023.0/63371: 76% mana arcane_charge, arcane_power, rune_of_power
1:48.890 aoe o arcane_explosion Fluffy_Pillow 47177.0/63371: 74% mana arcane_charge(2), arcane_power, rune_of_power
1:50.196 aoe o arcane_explosion Fluffy_Pillow 46332.3/63371: 73% mana arcane_charge(3), arcane_power, rune_of_power
1:51.501 aoe p arcane_barrage Fluffy_Pillow 45486.3/63371: 72% mana arcane_charge(4), arcane_power, rune_of_power
1:52.808 aoe m arcane_orb Fluffy_Pillow 49677.7/63371: 78% mana arcane_power, rune_of_power
1:54.115 aoe l rune_of_power Fluffy_Pillow 51084.2/63371: 81% mana arcane_charge(4)
1:55.423 aoe p arcane_barrage Fluffy_Pillow 52742.0/63371: 83% mana arcane_charge(4), rune_of_power
1:56.728 aoe o arcane_explosion Fluffy_Pillow 56930.9/63371: 90% mana rune_of_power
1:58.034 aoe o arcane_explosion Fluffy_Pillow 53586.1/63371: 85% mana arcane_charge, rune_of_power
1:59.340 aoe o arcane_explosion Fluffy_Pillow 50241.4/63371: 79% mana arcane_charge(2), rune_of_power
2:00.646 aoe o arcane_explosion Fluffy_Pillow 46896.6/63371: 74% mana arcane_charge(3), rune_of_power
2:01.955 aoe p arcane_barrage Fluffy_Pillow 43555.7/63371: 69% mana arcane_charge(4), rune_of_power
2:03.261 aoe o arcane_explosion Fluffy_Pillow 47745.8/63371: 75% mana rune_of_power
2:04.567 aoe o arcane_explosion Fluffy_Pillow 44401.1/63371: 70% mana arcane_charge, rune_of_power
2:05.873 aoe o arcane_explosion Fluffy_Pillow 41056.3/63371: 65% mana arcane_charge(2), rune_of_power
2:07.177 aoe o arcane_explosion Fluffy_Pillow 37709.1/63371: 60% mana arcane_charge(3), rune_of_power
2:08.484 aoe p arcane_barrage Fluffy_Pillow 34365.6/63371: 54% mana arcane_charge(4), rune_of_power
2:09.791 aoe o arcane_explosion Fluffy_Pillow 38557.0/63371: 61% mana rune_of_power
2:11.099 aoe n shifting_power Fluffy_Pillow 35214.8/63371: 56% mana arcane_charge
2:14.767 aoe o arcane_explosion Fluffy_Pillow 37363.7/63371: 59% mana arcane_charge
2:16.074 aoe o arcane_explosion Fluffy_Pillow 34020.2/63371: 54% mana arcane_charge(2)
2:17.381 aoe o arcane_explosion Fluffy_Pillow 30676.8/63371: 48% mana arcane_charge(3)
2:18.688 aoe p arcane_barrage Fluffy_Pillow 27333.3/63371: 43% mana arcane_charge(4)
2:19.994 aoe m arcane_orb Fluffy_Pillow 31523.4/63371: 50% mana
2:21.300 aoe p arcane_barrage Fluffy_Pillow 32678.7/63371: 52% mana arcane_charge(4)
2:22.607 aoe o arcane_explosion Fluffy_Pillow 36870.1/63371: 58% mana
2:23.913 shared_cds r use_mana_gem NightFae_Dream 33525.3/63371: 53% mana arcane_charge
2:23.913 aoe o arcane_explosion Fluffy_Pillow 39862.5/63371: 63% mana arcane_charge
2:25.219 aoe o arcane_explosion Fluffy_Pillow 36517.7/63371: 58% mana arcane_charge(2)
2:26.526 aoe o arcane_explosion Fluffy_Pillow 33174.3/63371: 52% mana arcane_charge(3)
2:27.833 aoe p arcane_barrage Fluffy_Pillow 29830.8/63371: 47% mana arcane_charge(4)
2:29.139 aoe j touch_of_the_magi Fluffy_Pillow 34020.9/63371: 54% mana
2:30.444 aoe l rune_of_power Fluffy_Pillow 33174.9/63371: 52% mana arcane_charge(4)
2:31.750 aoe p arcane_barrage Fluffy_Pillow 34830.2/63371: 55% mana arcane_charge(4), rune_of_power
2:33.056 aoe o arcane_explosion Fluffy_Pillow 39020.3/63371: 62% mana rune_of_power
2:34.363 aoe o arcane_explosion Fluffy_Pillow 35676.8/63371: 56% mana arcane_charge, clearcasting, rune_of_power
2:35.671 aoe o arcane_explosion Fluffy_Pillow 37334.6/63371: 59% mana arcane_charge(2), rune_of_power
2:36.978 aoe o arcane_explosion Fluffy_Pillow 33991.1/63371: 54% mana arcane_charge(3), rune_of_power
2:38.285 aoe p arcane_barrage Fluffy_Pillow 30647.7/63371: 48% mana arcane_charge(4), clearcasting, rune_of_power
2:39.590 aoe o arcane_explosion Fluffy_Pillow 34836.5/63371: 55% mana clearcasting, rune_of_power
2:40.896 aoe o arcane_explosion Fluffy_Pillow 36491.8/63371: 58% mana arcane_charge, rune_of_power
2:42.203 aoe o arcane_explosion Fluffy_Pillow 33148.3/63371: 52% mana arcane_charge(2), rune_of_power
2:43.509 aoe o arcane_explosion Fluffy_Pillow 29803.6/63371: 47% mana arcane_charge(3), rune_of_power
2:44.817 aoe p arcane_barrage Fluffy_Pillow 26461.4/63371: 42% mana arcane_charge(4), rune_of_power
2:46.124 aoe m arcane_orb Fluffy_Pillow 30652.8/63371: 48% mana rune_of_power
2:47.431 aoe p arcane_barrage Fluffy_Pillow 31809.3/63371: 50% mana arcane_charge(4)
2:48.738 aoe o arcane_explosion Fluffy_Pillow 36000.7/63371: 57% mana
2:50.045 aoe o arcane_explosion Fluffy_Pillow 32657.2/63371: 52% mana arcane_charge
2:51.352 aoe o arcane_explosion Fluffy_Pillow 29313.7/63371: 46% mana arcane_charge(2)
2:52.657 aoe o arcane_explosion Fluffy_Pillow 25967.7/63371: 41% mana arcane_charge(3)
2:53.963 aoe p arcane_barrage Fluffy_Pillow 22623.0/63371: 36% mana arcane_charge(4)
2:55.270 aoe o arcane_explosion Fluffy_Pillow 26814.4/63371: 42% mana
2:56.576 aoe n shifting_power Fluffy_Pillow 23469.6/63371: 37% mana arcane_charge
3:00.214 aoe o arcane_explosion Fluffy_Pillow 25580.5/63371: 40% mana arcane_charge
3:01.520 aoe o arcane_explosion Fluffy_Pillow 22235.8/63371: 35% mana arcane_charge(2)
3:02.826 aoe o arcane_explosion Fluffy_Pillow 18891.1/63371: 30% mana arcane_charge(3)
3:04.131 aoe p arcane_barrage Fluffy_Pillow 15545.1/63371: 25% mana arcane_charge(4), clearcasting
3:05.438 aoe m arcane_orb Fluffy_Pillow 19736.4/63371: 31% mana clearcasting
3:06.744 aoe p arcane_barrage Fluffy_Pillow 20891.7/63371: 33% mana arcane_charge(4), clearcasting
3:08.051 aoe o arcane_explosion Fluffy_Pillow 25083.1/63371: 40% mana clearcasting
3:09.358 aoe o arcane_explosion Fluffy_Pillow 26739.6/63371: 42% mana arcane_charge
3:10.664 aoe o arcane_explosion Fluffy_Pillow 23394.9/63371: 37% mana arcane_charge(2)
3:11.971 aoe o arcane_explosion Fluffy_Pillow 20051.4/63371: 32% mana arcane_charge(3)
3:13.279 aoe p arcane_barrage Fluffy_Pillow 16709.2/63371: 26% mana arcane_charge(4)
3:14.586 aoe j touch_of_the_magi Fluffy_Pillow 20900.6/63371: 33% mana
3:15.893 aoe k arcane_power Fluffy_Pillow 20057.1/63371: 32% mana arcane_charge(4), clearcasting
3:15.893 shared_cds t berserking Fluffy_Pillow 20057.1/63371: 32% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
3:15.893 aoe p arcane_barrage Fluffy_Pillow 20057.1/63371: 32% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
3:17.081 aoe o arcane_explosion Fluffy_Pillow 24097.7/63371: 38% mana berserking, arcane_power, clearcasting, rune_of_power
3:18.268 aoe o arcane_explosion Fluffy_Pillow 25602.1/63371: 40% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.457 aoe o arcane_explosion Fluffy_Pillow 24609.1/63371: 39% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.645 aoe o arcane_explosion Fluffy_Pillow 23614.8/63371: 37% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:21.834 aoe p arcane_barrage Fluffy_Pillow 22621.8/63371: 36% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.024 aoe o arcane_explosion Fluffy_Pillow 26664.9/63371: 42% mana berserking, arcane_power, rune_of_power
3:24.212 aoe o arcane_explosion Fluffy_Pillow 25670.6/63371: 41% mana berserking, arcane_charge, arcane_power, rune_of_power
3:25.399 aoe o arcane_explosion Fluffy_Pillow 24675.0/63371: 39% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:26.588 aoe o arcane_explosion Fluffy_Pillow 23682.0/63371: 37% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:27.776 aoe p arcane_barrage Fluffy_Pillow 22687.7/63371: 36% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:28.963 aoe m arcane_orb Fluffy_Pillow 26727.0/63371: 42% mana arcane_power, rune_of_power
3:30.269 aoe p arcane_barrage Fluffy_Pillow 28132.3/63371: 44% mana arcane_charge(4), arcane_power, rune_of_power
3:31.675 aoe o arcane_explosion Fluffy_Pillow 32449.1/63371: 51% mana
3:32.982 aoe o arcane_explosion Fluffy_Pillow 29105.6/63371: 46% mana arcane_charge
3:34.288 aoe o arcane_explosion Fluffy_Pillow 25760.9/63371: 41% mana arcane_charge(2)
3:35.594 aoe o arcane_explosion Fluffy_Pillow 22416.2/63371: 35% mana arcane_charge(3)
3:36.898 aoe l rune_of_power Fluffy_Pillow 19068.9/63371: 30% mana arcane_charge(4), clearcasting
3:38.204 aoe p arcane_barrage Fluffy_Pillow 20724.2/63371: 33% mana arcane_charge(4), clearcasting, rune_of_power
3:39.510 aoe o arcane_explosion Fluffy_Pillow 24914.3/63371: 39% mana clearcasting, rune_of_power
3:40.816 aoe o arcane_explosion Fluffy_Pillow 26569.5/63371: 42% mana arcane_charge, rune_of_power
3:42.123 aoe o arcane_explosion Fluffy_Pillow 23226.1/63371: 37% mana arcane_charge(2), rune_of_power
3:43.429 aoe o arcane_explosion Fluffy_Pillow 19881.3/63371: 31% mana arcane_charge(3), rune_of_power
3:44.736 aoe p arcane_barrage Fluffy_Pillow 16537.9/63371: 26% mana arcane_charge(4), rune_of_power
3:46.045 aoe o arcane_explosion Fluffy_Pillow 20731.8/63371: 33% mana rune_of_power
3:47.353 aoe o arcane_explosion Fluffy_Pillow 17389.6/63371: 27% mana arcane_charge, clearcasting, rune_of_power
3:48.661 aoe o arcane_explosion Fluffy_Pillow 19047.4/63371: 30% mana arcane_charge(2), rune_of_power
3:49.970 aoe o arcane_explosion Fluffy_Pillow 15706.4/63371: 25% mana arcane_charge(3), clearcasting, rune_of_power
3:51.275 aoe p arcane_barrage Fluffy_Pillow 17360.4/63371: 27% mana arcane_charge(4), rune_of_power
3:52.582 aoe m arcane_orb Fluffy_Pillow 21551.8/63371: 34% mana rune_of_power
3:53.889 aoe n shifting_power Fluffy_Pillow 22708.3/63371: 36% mana arcane_charge(4)
3:57.594 aoe p arcane_barrage Fluffy_Pillow 24904.2/63371: 39% mana arcane_charge(4)
3:58.900 aoe o arcane_explosion Fluffy_Pillow 29094.3/63371: 46% mana
4:00.206 aoe o arcane_explosion Fluffy_Pillow 25749.5/63371: 41% mana arcane_charge
4:01.511 aoe o arcane_explosion Fluffy_Pillow 22403.5/63371: 35% mana arcane_charge(2)
4:02.820 aoe o arcane_explosion Fluffy_Pillow 19062.6/63371: 30% mana arcane_charge(3)
4:04.128 aoe p arcane_barrage Fluffy_Pillow 15720.4/63371: 25% mana arcane_charge(4)
4:05.435 aoe m arcane_orb Fluffy_Pillow 19911.8/63371: 31% mana
4:06.741 aoe p arcane_barrage Fluffy_Pillow 21067.0/63371: 33% mana arcane_charge(4)
4:08.046 aoe o arcane_explosion Fluffy_Pillow 25255.9/63371: 40% mana
4:09.354 aoe o arcane_explosion Fluffy_Pillow 21913.7/63371: 35% mana arcane_charge
4:10.662 aoe j touch_of_the_magi Fluffy_Pillow 18571.5/63371: 29% mana arcane_charge(2), clearcasting
4:11.969 aoe l rune_of_power Fluffy_Pillow 17728.0/63371: 28% mana arcane_charge(4), clearcasting
4:13.277 aoe p arcane_barrage Fluffy_Pillow 19385.8/63371: 31% mana arcane_charge(4), clearcasting, rune_of_power
4:14.583 aoe o arcane_explosion Fluffy_Pillow 23575.9/63371: 37% mana clearcasting, rune_of_power
4:15.888 aoe o arcane_explosion Fluffy_Pillow 25229.9/63371: 40% mana arcane_charge, rune_of_power
4:17.196 aoe o arcane_explosion Fluffy_Pillow 21887.7/63371: 35% mana arcane_charge(2), rune_of_power
4:18.502 aoe o arcane_explosion Fluffy_Pillow 18543.0/63371: 29% mana arcane_charge(3), rune_of_power
4:19.810 aoe p arcane_barrage Fluffy_Pillow 15200.8/63371: 24% mana arcane_charge(4), clearcasting, rune_of_power
4:21.116 aoe o arcane_explosion Fluffy_Pillow 19390.9/63371: 31% mana clearcasting, rune_of_power
4:22.420 aoe o arcane_explosion Fluffy_Pillow 21043.6/63371: 33% mana arcane_charge, rune_of_power
4:23.727 shared_cds r use_mana_gem NightFae_Dream 17700.2/63371: 28% mana arcane_charge(2), rune_of_power
4:23.913 aoe o arcane_explosion Fluffy_Pillow 24273.0/63371: 38% mana arcane_charge(2), rune_of_power
4:25.219 aoe o arcane_explosion Fluffy_Pillow 20928.3/63371: 33% mana arcane_charge(3), clearcasting, rune_of_power
4:26.525 aoe p arcane_barrage Fluffy_Pillow 22583.6/63371: 36% mana arcane_charge(4), rune_of_power
4:27.833 aoe m arcane_orb Fluffy_Pillow 26776.2/63371: 42% mana rune_of_power
4:29.139 aoe p arcane_barrage Fluffy_Pillow 27931.5/63371: 44% mana arcane_charge(4)
4:30.448 aoe o arcane_explosion Fluffy_Pillow 32125.4/63371: 51% mana

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream_SB : 17613 dps, 4789 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17613.2 17613.2 22.0 / 0.125% 1381.4 / 7.8% 9.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
1888.4 1785.2 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 17613
Arcane Barrage 5908 33.5% 54.1 5.55sec 32612 26350 Direct 269.8 5487 10920 6536 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.05 269.84 0.00 0.00 1.2376 0.0000 1762753.44 1762753.44 0.00% 26349.87 26349.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 217.75 162 271 5486.66 2082 25810 5489.19 5015 5974 1194183 1194183 0.00%
crit 19.31% 52.09 29 79 10919.62 4164 51620 10930.91 8123 14625 568570 568570 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.07
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 488 2.8% 41.2 6.89sec 3538 0 Direct 206.1 593 1184 708 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.22 206.08 0.00 0.00 0.0000 0.0000 145809.14 145809.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 166.28 114 218 593.50 443 682 593.45 568 618 98674 98674 0.00%
crit 19.31% 39.80 20 69 1184.36 886 1364 1184.45 1082 1298 47135 47135 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7863 44.7% 142.1 2.08sec 16532 13296 Direct 710.4 2771 5540 3306 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.07 710.36 0.00 0.00 1.2434 0.0000 2348728.32 2348728.32 0.00% 13296.24 13296.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 573.14 456 713 2771.22 1958 4221 2770.87 2683 2859 1588318 1588318 0.00%
crit 19.32% 137.23 95 190 5539.97 3916 8442 5541.48 5078 5982 760411 760411 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.07
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1490) 0.0% (8.4%) 13.8 22.28sec 32172 26060

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.81 0.00 0.00 0.00 1.2346 0.0000 0.00 0.00 0.00% 26060.43 26060.43

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.81
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1490 8.4% 68.9 22.28sec 6445 0 Direct 68.9 5410 10865 6444 19.0%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.93 68.93 0.00 0.00 0.0000 0.0000 444252.07 444252.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.04% 55.86 37 75 5409.72 3869 8342 5420.03 4978 5906 302215 302215 0.00%
crit 18.96% 13.07 4 24 10864.63 7739 16685 10880.93 8210 14447 142037 142037 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (0.5%) 18.5 8.79sec 1417 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 0.5% 18.5 8.79sec 1417 0 Direct 18.5 1181 2364 1417 19.9%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.47 18.47 0.00 0.00 0.0000 0.0000 26159.26 26159.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.10% 14.79 5 28 1181.28 1164 1195 1181.34 1170 1195 17473 17473 0.00%
crit 19.90% 3.67 0 11 2363.70 2327 2389 2303.31 0 2389 8686 8686 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1520 3040 1807 18.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1805.38 1805.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.24% 0.81 0 1 1520.16 1520 1520 1234.94 0 1520 1235 1235 0.00%
crit 18.76% 0.19 0 1 3040.32 3040 3040 570.43 0 3040 570 570 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.1%) 1.0 0.00sec 6124 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 153  / 21 0.1% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6124.26 6124.26 0.00% 52.00 52.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.51% 72.45 60 83 56.98 43 62 56.98 56 58 4128 4128 0.00%
crit 19.49% 17.55 7 30 113.76 86 124 113.77 103 123 1996 1996 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 654 3.7% 5.9 49.55sec 33104 9281 Periodic 117.5 1394 2788 1665 19.4% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.91 0.00 23.50 117.50 3.5668 0.8340 195662.63 195662.63 0.00% 9281.03 9281.03
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.56% 94.65 68 126 1394.19 1372 1409 1394.03 1388 1400 131962 131962 0.00%
crit 19.44% 22.85 9 44 2788.04 2745 2818 2787.70 2762 2813 63700 63700 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.91
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1097) 0.0% (6.2%) 6.6 49.17sec 50002 38275

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.55 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 38275.05 38275.05

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.59
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1097 6.2% 6.6 49.01sec 50002 0 Direct 32.6 10072 0 10072 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.55 32.56 0.00 0.00 0.0000 0.0000 327519.60 327519.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.56 25 40 10071.76 2616 47767 10075.19 8461 12994 327520 327520 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5848.98
  • base_dd_max:5848.98
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream_SB
Arcane Power 3.5 97.20sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.55
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.66sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.2 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.25 0.00 1.47 0.00 4.3032 0.7222 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.25
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.48sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.46
  • if_expr:buff.arcane_power.up
Rune of Power 6.3 47.98sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.34 0.00 0.00 0.00 1.2592 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.37
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.70sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.79
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 54.8 176.5 5.5sec 1.3sec 4.2sec 76.30% 0.00% 31.0 (32.9) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 9.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.6s

Stack Uptimes

  • arcane_charge_1:21.31%
  • arcane_charge_2:18.89%
  • arcane_charge_3:14.52%
  • arcane_charge_4:21.57%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.5 0.0 97.2sec 97.2sec 14.7sec 17.45% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.0s

Stack Uptimes

  • arcane_power_1:17.45%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.14% 23.70% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.7s / 199.2s
  • trigger_min/max:192.7s / 199.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.14%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.3 0.2 13.0sec 12.9sec 2.2sec 16.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.06%
  • clearcasting_2:0.22%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.2 0.0 0.0sec 0.0sec 4.3sec 0.36% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 4.3s

Stack Uptimes

  • evocation_1:0.37%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.2sec 11.18% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.18%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.9 0.0 31.5sec 31.5sec 14.6sec 48.41% 0.00% 0.0 (0.0) 9.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.7s
  • trigger_min/max:16.8s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.41%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Social Butterfly 30.4 0.0 10.0sec 10.0sec 5.0sec 50.42% 0.00% 0.0 (0.0) 29.9

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.42%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.59% 0.77% 6.08% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000202.911144.053263.917
Evocation225.542125.866352.504285.534179.967359.855
Rune of Power14.2250.00557.59693.50476.731111.766
Touch of the Magi10.8850.00018.68673.68953.57292.941
Arcane Power1.2340.0076.0924.3932.4578.864
Arcane Barrage3.0370.00012.263165.505132.376202.272
Arcane Orb4.5960.00013.25664.03847.64482.745
Shifting Power9.3910.00037.76355.60650.18979.314

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
mana_regen Mana 681.96 371306.78 69.58% 544.47 7031.54 1.86%
Evocation Mana 11.71 11777.46 2.21% 1005.69 0.00 0.00%
Mana Gem Mana 2.79 17681.49 3.31% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.07 132840.13 24.89% 2457.01 4208.86 3.07%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1785.17 1888.43 11247.7 32503.1 2266.7 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
arcane_explosion Mana 142.1 526138.8 3703.4 3703.3 4.5
arcane_orb Mana 13.8 6150.6 445.3 445.4 72.2
shifting_power Mana 5.9 14780.0 2500.0 2500.6 13.2
touch_of_the_magi Mana 6.6 16392.6 2500.0 2502.7 20.0

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
NightFae_Dream_SB Damage Per Second
Count 1018
Mean 17613.19
Minimum 16526.12
Maximum 18834.94
Spread ( max - min ) 2308.81
Range [ ( max - min ) / 2 * 100% ] 6.55%
Standard Deviation 358.8350
5th Percentile 17018.74
95th Percentile 18203.26
( 95th Percentile - 5th Percentile ) 1184.51
Mean Distribution
Standard Deviation 11.2466
95.00% Confidence Interval ( 17591.14 - 17635.23 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1595
0.1 Scale Factor Error with Delta=300 1100
0.05 Scale Factor Error with Delta=300 4397
0.01 Scale Factor Error with Delta=300 109920
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 1018
Mean 4789.47
Minimum 4286.17
Maximum 5381.10
Spread ( max - min ) 1094.93
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 166.3681
5th Percentile 4514.72
95th Percentile 5054.68
( 95th Percentile - 5th Percentile ) 539.96
Mean Distribution
Standard Deviation 5.2143
95.00% Confidence Interval ( 4779.25 - 4799.69 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4636
0.1 Scale Factor Error with Delta=300 237
0.05 Scale Factor Error with Delta=300 946
0.01 Scale Factor Error with Delta=300 23628
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 1018
Mean 17613.19
Minimum 16526.12
Maximum 18834.94
Spread ( max - min ) 2308.81
Range [ ( max - min ) / 2 * 100% ] 6.55%
Damage
NightFae_Dream_SB Damage
Count 1018
Mean 5252689.84
Minimum 4207262.40
Maximum 6346937.65
Spread ( max - min ) 2139675.25
Range [ ( max - min ) / 2 * 100% ] 20.37%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.59 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.55 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.37 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.81 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.91 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.07 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.07 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.25 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.79 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.46 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooropmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmproooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpooooporooopmpo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana social_butterfly
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), social_butterfly
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:01.306 aoe p arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:02.219 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:03.135 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.050 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.965 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:05.881 aoe o arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.794 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:07.708 aoe p arcane_barrage Fluffy_Pillow 60507.7/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.622 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.538 aoe o arcane_explosion Fluffy_Pillow 62032.4/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.453 aoe o arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:11.369 aoe o arcane_explosion Fluffy_Pillow 59353.1/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:12.285 aoe p arcane_barrage Fluffy_Pillow 58014.0/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:13.199 aoe o arcane_explosion Fluffy_Pillow 61707.3/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:14.114 aoe o arcane_explosion Fluffy_Pillow 60367.0/63371: 95% mana bloodlust, arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:15.121 aoe o arcane_explosion Fluffy_Pillow 59143.3/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.127 aoe o arcane_explosion Fluffy_Pillow 57918.3/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.134 aoe l rune_of_power Fluffy_Pillow 56694.6/63371: 89% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.140 aoe p arcane_barrage Fluffy_Pillow 57969.7/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.148 aoe o arcane_explosion Fluffy_Pillow 61782.1/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.154 aoe o arcane_explosion Fluffy_Pillow 58057.1/63371: 92% mana bloodlust, arcane_charge, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:21.161 aoe o arcane_explosion Fluffy_Pillow 54333.4/63371: 86% mana bloodlust, arcane_charge(2), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:22.167 shared_cds r use_mana_gem NightFae_Dream_SB 50608.5/63371: 80% mana bloodlust, arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:22.167 aoe o arcane_explosion Fluffy_Pillow 56945.6/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.174 aoe p arcane_barrage Fluffy_Pillow 53221.9/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:24.179 aoe m arcane_orb Fluffy_Pillow 57030.5/63371: 90% mana bloodlust, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:25.187 aoe p arcane_barrage Fluffy_Pillow 57808.1/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.194 aoe o arcane_explosion Fluffy_Pillow 61619.3/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.203 aoe o arcane_explosion Fluffy_Pillow 57898.1/63371: 91% mana bloodlust, arcane_charge, rune_of_power
0:28.209 aoe o arcane_explosion Fluffy_Pillow 54173.1/63371: 85% mana bloodlust, arcane_charge(2), rune_of_power
0:29.217 aoe o arcane_explosion Fluffy_Pillow 50450.7/63371: 80% mana bloodlust, arcane_charge(3), rune_of_power
0:30.225 aoe p arcane_barrage Fluffy_Pillow 46728.3/63371: 74% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly
0:31.232 aoe o arcane_explosion Fluffy_Pillow 50539.4/63371: 80% mana bloodlust, rune_of_power, social_butterfly
0:32.239 aoe o arcane_explosion Fluffy_Pillow 46815.7/63371: 74% mana bloodlust, arcane_charge, clearcasting, rune_of_power, social_butterfly
0:33.247 aoe n shifting_power Fluffy_Pillow 48093.3/63371: 76% mana bloodlust, arcane_charge(2), social_butterfly
0:36.187 aoe o arcane_explosion Fluffy_Pillow 49319.5/63371: 78% mana bloodlust, arcane_charge(2)
0:37.194 aoe o arcane_explosion Fluffy_Pillow 45595.8/63371: 72% mana bloodlust, arcane_charge(3)
0:38.202 aoe p arcane_barrage Fluffy_Pillow 41873.4/63371: 66% mana bloodlust, arcane_charge(4)
0:39.209 aoe m arcane_orb Fluffy_Pillow 45684.6/63371: 72% mana bloodlust
0:40.215 aoe p arcane_barrage Fluffy_Pillow 46459.6/63371: 73% mana bloodlust, arcane_charge(4), social_butterfly
0:41.221 aoe o arcane_explosion Fluffy_Pillow 50269.5/63371: 79% mana social_butterfly
0:42.527 aoe o arcane_explosion Fluffy_Pillow 46924.7/63371: 74% mana arcane_charge, social_butterfly
0:43.833 aoe o arcane_explosion Fluffy_Pillow 43580.0/63371: 69% mana arcane_charge(2), social_butterfly
0:45.140 aoe o arcane_explosion Fluffy_Pillow 40236.5/63371: 63% mana arcane_charge(3)
0:46.446 aoe p arcane_barrage Fluffy_Pillow 36891.8/63371: 58% mana arcane_charge(4)
0:47.752 aoe o arcane_explosion Fluffy_Pillow 41081.9/63371: 65% mana
0:49.058 aoe o arcane_explosion Fluffy_Pillow 37737.2/63371: 60% mana arcane_charge
0:50.365 aoe j touch_of_the_magi Fluffy_Pillow 34393.7/63371: 54% mana arcane_charge(2), social_butterfly
0:51.672 aoe l rune_of_power Fluffy_Pillow 33550.2/63371: 53% mana arcane_charge(4), social_butterfly
0:52.980 aoe p arcane_barrage Fluffy_Pillow 35208.0/63371: 56% mana arcane_charge(4), rune_of_power, social_butterfly
0:54.286 aoe o arcane_explosion Fluffy_Pillow 39398.1/63371: 62% mana rune_of_power, social_butterfly
0:55.592 aoe o arcane_explosion Fluffy_Pillow 36053.4/63371: 57% mana arcane_charge, rune_of_power
0:56.899 aoe o arcane_explosion Fluffy_Pillow 32709.9/63371: 52% mana arcane_charge(2), rune_of_power
0:58.205 aoe o arcane_explosion Fluffy_Pillow 29365.2/63371: 46% mana arcane_charge(3), rune_of_power
0:59.512 aoe p arcane_barrage Fluffy_Pillow 26021.7/63371: 41% mana arcane_charge(4), rune_of_power
1:00.817 aoe m arcane_orb Fluffy_Pillow 30210.6/63371: 48% mana rune_of_power, social_butterfly
1:02.123 aoe p arcane_barrage Fluffy_Pillow 31365.8/63371: 49% mana arcane_charge(4), rune_of_power, social_butterfly
1:03.428 aoe o arcane_explosion Fluffy_Pillow 35554.7/63371: 56% mana rune_of_power, social_butterfly
1:04.736 aoe o arcane_explosion Fluffy_Pillow 32212.5/63371: 51% mana arcane_charge, clearcasting, rune_of_power, social_butterfly
1:06.043 aoe o arcane_explosion Fluffy_Pillow 33869.0/63371: 53% mana arcane_charge(2), rune_of_power
1:07.352 aoe o arcane_explosion Fluffy_Pillow 30528.1/63371: 48% mana arcane_charge(3), rune_of_power
1:08.659 aoe p arcane_barrage Fluffy_Pillow 27184.6/63371: 43% mana arcane_charge(4)
1:09.966 aoe o arcane_explosion Fluffy_Pillow 31376.0/63371: 50% mana
1:11.271 aoe o arcane_explosion Fluffy_Pillow 28030.0/63371: 44% mana arcane_charge, social_butterfly
1:12.578 aoe o arcane_explosion Fluffy_Pillow 24686.5/63371: 39% mana arcane_charge(2), clearcasting, social_butterfly
1:13.885 aoe o arcane_explosion Fluffy_Pillow 26343.0/63371: 42% mana arcane_charge(3), social_butterfly
1:15.191 aoe p arcane_barrage Fluffy_Pillow 22998.3/63371: 36% mana arcane_charge(4), clearcasting
1:16.496 aoe o arcane_explosion Fluffy_Pillow 27187.2/63371: 43% mana clearcasting
1:17.802 aoe o arcane_explosion Fluffy_Pillow 28842.4/63371: 46% mana arcane_charge
1:19.111 aoe n shifting_power Fluffy_Pillow 25501.5/63371: 40% mana arcane_charge(2)
1:22.743 aoe o arcane_explosion Fluffy_Pillow 27604.8/63371: 44% mana arcane_charge(2), social_butterfly
1:24.049 aoe o arcane_explosion Fluffy_Pillow 24260.0/63371: 38% mana arcane_charge(3), social_butterfly
1:25.355 aoe p arcane_barrage Fluffy_Pillow 20915.3/63371: 33% mana arcane_charge(4), clearcasting
1:26.661 aoe m arcane_orb Fluffy_Pillow 25105.4/63371: 40% mana clearcasting
1:27.967 aoe p arcane_barrage Fluffy_Pillow 26260.7/63371: 41% mana arcane_charge(4), clearcasting(2)
1:29.273 aoe o arcane_explosion Fluffy_Pillow 30450.8/63371: 48% mana clearcasting(2)
1:30.578 aoe o arcane_explosion Fluffy_Pillow 32104.8/63371: 51% mana arcane_charge, clearcasting, social_butterfly
1:31.886 aoe o arcane_explosion Fluffy_Pillow 33762.6/63371: 53% mana arcane_charge(2), social_butterfly
1:33.193 aoe o arcane_explosion Fluffy_Pillow 30419.1/63371: 48% mana arcane_charge(3), social_butterfly
1:34.497 aoe p arcane_barrage Fluffy_Pillow 27071.9/63371: 43% mana arcane_charge(4), social_butterfly
1:35.803 aoe o arcane_explosion Fluffy_Pillow 31262.0/63371: 49% mana
1:37.111 aoe j touch_of_the_magi Fluffy_Pillow 27919.8/63371: 44% mana arcane_charge
1:38.416 aoe k arcane_power Fluffy_Pillow 27073.8/63371: 43% mana arcane_charge(4)
1:38.416 aoe p arcane_barrage Fluffy_Pillow 27073.8/63371: 43% mana arcane_charge(4), arcane_power, rune_of_power
1:39.723 aoe o arcane_explosion Fluffy_Pillow 31265.2/63371: 49% mana arcane_power, rune_of_power
1:41.030 aoe o arcane_explosion Fluffy_Pillow 30421.7/63371: 48% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
1:42.336 aoe o arcane_explosion Fluffy_Pillow 29576.9/63371: 47% mana arcane_charge(2), arcane_power, rune_of_power, social_butterfly
1:43.643 aoe o arcane_explosion Fluffy_Pillow 28733.5/63371: 45% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly
1:44.949 aoe p arcane_barrage Fluffy_Pillow 27888.7/63371: 44% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, social_butterfly
1:46.255 aoe o arcane_explosion Fluffy_Pillow 32078.9/63371: 51% mana arcane_power, clearcasting, rune_of_power
1:47.561 aoe o arcane_explosion Fluffy_Pillow 33734.1/63371: 53% mana arcane_charge, arcane_power, rune_of_power
1:48.869 aoe o arcane_explosion Fluffy_Pillow 32891.9/63371: 52% mana arcane_charge(2), arcane_power, rune_of_power
1:50.177 aoe o arcane_explosion Fluffy_Pillow 32049.7/63371: 51% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly
1:51.483 aoe p arcane_barrage Fluffy_Pillow 31205.0/63371: 49% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
1:52.789 aoe m arcane_orb Fluffy_Pillow 35395.1/63371: 56% mana arcane_power, rune_of_power, social_butterfly
1:54.095 aoe l rune_of_power Fluffy_Pillow 36800.4/63371: 58% mana arcane_charge(4), social_butterfly
1:55.401 aoe p arcane_barrage Fluffy_Pillow 38455.6/63371: 61% mana arcane_charge(4), rune_of_power
1:56.708 aoe o arcane_explosion Fluffy_Pillow 42647.0/63371: 67% mana rune_of_power
1:58.014 aoe o arcane_explosion Fluffy_Pillow 39302.3/63371: 62% mana arcane_charge, clearcasting, rune_of_power
1:59.320 aoe o arcane_explosion Fluffy_Pillow 40957.5/63371: 65% mana arcane_charge(2), rune_of_power
2:00.629 aoe o arcane_explosion Fluffy_Pillow 37616.6/63371: 59% mana arcane_charge(3), rune_of_power, social_butterfly
2:01.936 aoe p arcane_barrage Fluffy_Pillow 34273.1/63371: 54% mana arcane_charge(4), rune_of_power, social_butterfly
2:03.243 aoe o arcane_explosion Fluffy_Pillow 38464.5/63371: 61% mana rune_of_power, social_butterfly
2:04.548 aoe o arcane_explosion Fluffy_Pillow 35118.5/63371: 55% mana arcane_charge, rune_of_power, social_butterfly
2:05.854 aoe o arcane_explosion Fluffy_Pillow 31773.8/63371: 50% mana arcane_charge(2), rune_of_power
2:07.160 aoe o arcane_explosion Fluffy_Pillow 28429.0/63371: 45% mana arcane_charge(3), rune_of_power
2:08.466 aoe p arcane_barrage Fluffy_Pillow 25084.3/63371: 40% mana arcane_charge(4), rune_of_power
2:09.770 aoe o arcane_explosion Fluffy_Pillow 29271.9/63371: 46% mana rune_of_power
2:11.077 aoe n shifting_power Fluffy_Pillow 25928.4/63371: 41% mana arcane_charge, social_butterfly
2:14.771 aoe o arcane_explosion Fluffy_Pillow 28110.3/63371: 44% mana arcane_charge, social_butterfly
2:16.079 aoe o arcane_explosion Fluffy_Pillow 24768.1/63371: 39% mana arcane_charge(2)
2:17.383 aoe o arcane_explosion Fluffy_Pillow 21420.8/63371: 34% mana arcane_charge(3)
2:18.687 aoe p arcane_barrage Fluffy_Pillow 18073.5/63371: 29% mana arcane_charge(4), clearcasting
2:19.993 aoe m arcane_orb Fluffy_Pillow 22263.6/63371: 35% mana clearcasting
2:21.300 aoe p arcane_barrage Fluffy_Pillow 23420.2/63371: 37% mana arcane_charge(4), clearcasting, social_butterfly
2:22.608 shared_cds r use_mana_gem NightFae_Dream_SB 27612.8/63371: 44% mana clearcasting, social_butterfly
2:22.608 aoe o arcane_explosion Fluffy_Pillow 33950.0/63371: 54% mana clearcasting, social_butterfly
2:23.918 aoe o arcane_explosion Fluffy_Pillow 35610.3/63371: 56% mana arcane_charge, social_butterfly
2:25.224 aoe o arcane_explosion Fluffy_Pillow 32265.6/63371: 51% mana arcane_charge(2)
2:26.530 aoe o arcane_explosion Fluffy_Pillow 28920.8/63371: 46% mana arcane_charge(3)
2:27.836 aoe p arcane_barrage Fluffy_Pillow 25576.1/63371: 40% mana arcane_charge(4)
2:29.140 aoe j touch_of_the_magi Fluffy_Pillow 29763.7/63371: 47% mana
2:30.447 aoe l rune_of_power Fluffy_Pillow 28920.2/63371: 46% mana arcane_charge(4), social_butterfly
2:31.755 aoe p arcane_barrage Fluffy_Pillow 30578.0/63371: 48% mana arcane_charge(4), rune_of_power, social_butterfly
2:33.061 aoe o arcane_explosion Fluffy_Pillow 34768.1/63371: 55% mana rune_of_power, social_butterfly
2:34.368 aoe o arcane_explosion Fluffy_Pillow 31424.6/63371: 50% mana arcane_charge, rune_of_power, social_butterfly
2:35.673 aoe o arcane_explosion Fluffy_Pillow 28078.6/63371: 44% mana arcane_charge(2), rune_of_power
2:36.980 aoe o arcane_explosion Fluffy_Pillow 24735.2/63371: 39% mana arcane_charge(3), rune_of_power
2:38.284 aoe p arcane_barrage Fluffy_Pillow 21387.9/63371: 34% mana arcane_charge(4), rune_of_power
2:39.592 aoe o arcane_explosion Fluffy_Pillow 25580.5/63371: 40% mana rune_of_power
2:40.900 aoe o arcane_explosion Fluffy_Pillow 22238.3/63371: 35% mana arcane_charge, rune_of_power, social_butterfly
2:42.206 aoe o arcane_explosion Fluffy_Pillow 18893.6/63371: 30% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
2:43.513 aoe o arcane_explosion Fluffy_Pillow 20550.1/63371: 32% mana arcane_charge(3), rune_of_power, social_butterfly
2:44.820 aoe p arcane_barrage Fluffy_Pillow 17206.7/63371: 27% mana arcane_charge(4), rune_of_power, social_butterfly
2:46.127 aoe m arcane_orb Fluffy_Pillow 21398.1/63371: 34% mana rune_of_power
2:47.432 aoe p arcane_barrage Fluffy_Pillow 22552.0/63371: 36% mana arcane_charge(4)
2:48.737 aoe o arcane_explosion Fluffy_Pillow 26740.9/63371: 42% mana
2:50.042 aoe o arcane_explosion Fluffy_Pillow 23394.9/63371: 37% mana arcane_charge, social_butterfly
2:51.351 aoe o arcane_explosion Fluffy_Pillow 20054.0/63371: 32% mana arcane_charge(2), social_butterfly
2:52.660 aoe o arcane_explosion Fluffy_Pillow 16713.0/63371: 26% mana arcane_charge(3), social_butterfly
2:53.968 aoe p arcane_barrage Fluffy_Pillow 13370.8/63371: 21% mana arcane_charge(4), social_butterfly
2:55.276 aoe o arcane_explosion Fluffy_Pillow 17563.5/63371: 28% mana
2:56.583 aoe n shifting_power Fluffy_Pillow 14220.0/63371: 22% mana arcane_charge
3:00.291 aoe o arcane_explosion Fluffy_Pillow 16419.6/63371: 26% mana arcane_charge, social_butterfly
3:01.596 aoe o arcane_explosion Fluffy_Pillow 13073.6/63371: 21% mana arcane_charge(2), social_butterfly
3:02.903 aoe o arcane_explosion Fluffy_Pillow 9730.1/63371: 15% mana arcane_charge(3), social_butterfly
3:04.209 aoe p arcane_barrage Fluffy_Pillow 6385.4/63371: 10% mana arcane_charge(4), clearcasting, social_butterfly
3:05.513 aoe m arcane_orb Fluffy_Pillow 10573.0/63371: 17% mana clearcasting
3:06.820 aoe p arcane_barrage Fluffy_Pillow 11729.5/63371: 19% mana arcane_charge(4), clearcasting(2)
3:08.128 aoe o arcane_explosion Fluffy_Pillow 15922.2/63371: 25% mana clearcasting(2)
3:09.435 aoe o arcane_explosion Fluffy_Pillow 17578.7/63371: 28% mana arcane_charge, clearcasting
3:10.742 aoe o arcane_explosion Fluffy_Pillow 19235.2/63371: 30% mana arcane_charge(2), social_butterfly
3:12.049 aoe o arcane_explosion Fluffy_Pillow 15891.8/63371: 25% mana arcane_charge(3), social_butterfly
3:13.356 aoe p arcane_barrage Fluffy_Pillow 12548.3/63371: 20% mana arcane_charge(4), clearcasting, social_butterfly
3:14.662 aoe j touch_of_the_magi Fluffy_Pillow 16738.4/63371: 26% mana clearcasting, social_butterfly
3:15.967 aoe k arcane_power Fluffy_Pillow 15892.4/63371: 25% mana arcane_charge(4), clearcasting
3:15.967 shared_cds t berserking Fluffy_Pillow 15892.4/63371: 25% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
3:15.967 aoe p arcane_barrage Fluffy_Pillow 15892.4/63371: 25% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
3:17.155 aoe o arcane_explosion Fluffy_Pillow 19933.0/63371: 31% mana berserking, arcane_power, clearcasting(2), rune_of_power
3:18.343 aoe o arcane_explosion Fluffy_Pillow 21438.7/63371: 34% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power
3:19.531 aoe o arcane_explosion Fluffy_Pillow 22944.4/63371: 36% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.719 aoe o arcane_explosion Fluffy_Pillow 21950.1/63371: 35% mana berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly
3:21.908 aoe p arcane_barrage Fluffy_Pillow 20957.1/63371: 33% mana berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:23.097 aoe o arcane_explosion Fluffy_Pillow 24998.9/63371: 39% mana berserking, arcane_power, rune_of_power, social_butterfly
3:24.285 aoe o arcane_explosion Fluffy_Pillow 24004.6/63371: 38% mana berserking, arcane_charge, arcane_power, rune_of_power, social_butterfly
3:25.475 aoe o arcane_explosion Fluffy_Pillow 23012.8/63371: 36% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:26.663 aoe o arcane_explosion Fluffy_Pillow 22018.5/63371: 35% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:27.853 aoe p arcane_barrage Fluffy_Pillow 21026.8/63371: 33% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:29.041 aoe m arcane_orb Fluffy_Pillow 25067.3/63371: 40% mana arcane_power, rune_of_power
3:30.348 aoe p arcane_barrage Fluffy_Pillow 26473.9/63371: 42% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:31.755 aoe o arcane_explosion Fluffy_Pillow 30792.0/63371: 49% mana social_butterfly
3:33.063 aoe o arcane_explosion Fluffy_Pillow 27449.8/63371: 43% mana arcane_charge, social_butterfly
3:34.369 aoe o arcane_explosion Fluffy_Pillow 24105.1/63371: 38% mana arcane_charge(2), social_butterfly
3:35.677 aoe o arcane_explosion Fluffy_Pillow 20762.9/63371: 33% mana arcane_charge(3)
3:36.984 aoe l rune_of_power Fluffy_Pillow 17419.4/63371: 27% mana arcane_charge(4)
3:38.289 aoe p arcane_barrage Fluffy_Pillow 19073.4/63371: 30% mana arcane_charge(4), rune_of_power
3:39.597 aoe o arcane_explosion Fluffy_Pillow 23266.0/63371: 37% mana rune_of_power
3:40.900 aoe o arcane_explosion Fluffy_Pillow 19917.5/63371: 31% mana arcane_charge, clearcasting, rune_of_power, social_butterfly
3:42.207 aoe o arcane_explosion Fluffy_Pillow 21574.0/63371: 34% mana arcane_charge(2), rune_of_power, social_butterfly
3:43.513 aoe o arcane_explosion Fluffy_Pillow 18229.3/63371: 29% mana arcane_charge(3), rune_of_power, social_butterfly
3:44.819 aoe p arcane_barrage Fluffy_Pillow 14884.5/63371: 23% mana arcane_charge(4), rune_of_power, social_butterfly
3:46.125 aoe o arcane_explosion Fluffy_Pillow 19074.7/63371: 30% mana rune_of_power
3:47.434 aoe o arcane_explosion Fluffy_Pillow 15733.7/63371: 25% mana arcane_charge, rune_of_power
3:48.739 aoe o arcane_explosion Fluffy_Pillow 12387.7/63371: 20% mana arcane_charge(2), rune_of_power
3:50.048 aoe o arcane_explosion Fluffy_Pillow 9046.8/63371: 14% mana arcane_charge(3), clearcasting, rune_of_power, social_butterfly
3:51.356 aoe p arcane_barrage Fluffy_Pillow 10704.6/63371: 17% mana arcane_charge(4), rune_of_power, social_butterfly
3:52.662 aoe m arcane_orb Fluffy_Pillow 14894.7/63371: 24% mana rune_of_power, social_butterfly
3:53.970 aoe n shifting_power Fluffy_Pillow 16052.5/63371: 25% mana arcane_charge(4), social_butterfly
3:57.683 aoe p arcane_barrage Fluffy_Pillow 18258.5/63371: 29% mana arcane_charge(4)
3:58.989 aoe o arcane_explosion Fluffy_Pillow 22448.6/63371: 35% mana
4:00.296 aoe o arcane_explosion Fluffy_Pillow 19105.1/63371: 30% mana arcane_charge, clearcasting, social_butterfly
4:01.602 aoe o arcane_explosion Fluffy_Pillow 20760.4/63371: 33% mana arcane_charge(2), social_butterfly
4:02.907 aoe o arcane_explosion Fluffy_Pillow 17414.4/63371: 27% mana arcane_charge(3), social_butterfly
4:04.213 aoe p arcane_barrage Fluffy_Pillow 14069.6/63371: 22% mana arcane_charge(4), clearcasting, social_butterfly
4:05.518 aoe m arcane_orb Fluffy_Pillow 18258.5/63371: 29% mana clearcasting
4:06.826 aoe p arcane_barrage Fluffy_Pillow 19416.3/63371: 31% mana arcane_charge(4), clearcasting
4:08.133 aoe o arcane_explosion Fluffy_Pillow 23607.7/63371: 37% mana clearcasting
4:09.439 aoe o arcane_explosion Fluffy_Pillow 25262.9/63371: 40% mana arcane_charge
4:10.746 aoe j touch_of_the_magi Fluffy_Pillow 21919.4/63371: 35% mana arcane_charge(2), social_butterfly
4:12.053 aoe l rune_of_power Fluffy_Pillow 21076.0/63371: 33% mana arcane_charge(4), clearcasting, social_butterfly
4:13.360 aoe p arcane_barrage Fluffy_Pillow 22732.5/63371: 36% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
4:14.667 aoe o arcane_explosion Fluffy_Pillow 26923.9/63371: 42% mana clearcasting, rune_of_power, social_butterfly
4:15.974 aoe o arcane_explosion Fluffy_Pillow 28580.4/63371: 45% mana arcane_charge, rune_of_power
4:17.279 aoe o arcane_explosion Fluffy_Pillow 25234.4/63371: 40% mana arcane_charge(2), rune_of_power
4:18.587 aoe o arcane_explosion Fluffy_Pillow 21892.2/63371: 35% mana arcane_charge(3), rune_of_power
4:19.894 aoe p arcane_barrage Fluffy_Pillow 18548.7/63371: 29% mana arcane_charge(4), rune_of_power
4:21.201 aoe o arcane_explosion Fluffy_Pillow 22740.1/63371: 36% mana rune_of_power, social_butterfly
4:22.509 shared_cds r use_mana_gem NightFae_Dream_SB 19397.9/63371: 31% mana arcane_charge, rune_of_power, social_butterfly
4:22.608 aoe o arcane_explosion Fluffy_Pillow 25860.5/63371: 41% mana arcane_charge, rune_of_power, social_butterfly
4:23.915 aoe o arcane_explosion Fluffy_Pillow 22517.1/63371: 36% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
4:25.220 aoe o arcane_explosion Fluffy_Pillow 24171.1/63371: 38% mana arcane_charge(3), rune_of_power
4:26.526 aoe p arcane_barrage Fluffy_Pillow 20826.3/63371: 33% mana arcane_charge(4), rune_of_power
4:27.832 aoe m arcane_orb Fluffy_Pillow 25016.4/63371: 39% mana rune_of_power
4:29.138 aoe p arcane_barrage Fluffy_Pillow 26171.7/63371: 41% mana arcane_charge(4)
4:30.445 aoe o arcane_explosion Fluffy_Pillow 30363.1/63371: 48% mana social_butterfly

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream_SB"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=319210//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Koraylon : 17870 dps, 4861 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17870.3 17870.3 22.5 / 0.126% 1438.1 / 8.0% 9.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
1886.1 1786.7 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Koraylon 17870
Arcane Barrage 5961 33.3% 54.1 5.55sec 32905 26587 Direct 269.9 5520 11081 6593 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.05 269.86 0.00 0.00 1.2376 0.0000 1778556.71 1778556.71 0.00% 26587.29 26587.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 217.77 165 278 5520.06 2082 25140 5523.18 4894 5924 1201582 1201582 0.00%
crit 19.30% 52.09 22 77 11081.50 4164 50280 11087.94 8404 14964 576974 576974 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.06
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 499 2.8% 41.2 6.91sec 3614 0 Direct 206.0 606 1210 723 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.20 205.99 0.00 0.00 0.0000 0.0000 148873.71 148873.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 166.14 119 214 605.90 443 731 606.19 568 634 100660 100660 0.00%
crit 19.34% 39.84 20 62 1210.06 886 1462 1210.60 1101 1315 48214 48214 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7996 44.8% 142.0 2.08sec 16816 13525 Direct 710.0 2820 5637 3363 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.00 710.00 0.00 0.00 1.2433 0.0000 2387875.26 2387875.26 0.00% 13524.98 13524.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 573.13 454 701 2820.06 1958 4523 2820.30 2721 2937 1616346 1616346 0.00%
crit 19.28% 136.87 91 188 5636.91 3916 9045 5637.55 5212 6108 771529 771529 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.00
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1521) 0.0% (8.5%) 13.8 22.33sec 32826 26591

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.81 0.00 0.00 0.00 1.2345 0.0000 0.00 0.00 0.00% 26591.03 26591.03

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.81
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1521 8.5% 69.0 22.33sec 6573 0 Direct 69.0 5506 11012 6572 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.97 68.97 0.00 0.00 0.0000 0.0000 453377.03 453377.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 55.61 36 74 5505.93 3869 8938 5515.91 5025 6018 306242 306242 0.00%
crit 19.37% 13.36 4 25 11011.78 7739 17876 11036.77 8513 14394 147135 147135 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (92) 0.0% (0.5%) 18.4 8.96sec 1503 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.43 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 92 0.5% 18.4 8.96sec 1503 0 Direct 18.4 1255 2512 1503 19.7%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.43 18.43 0.00 0.00 0.0000 0.0000 27688.27 27688.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.29% 14.79 5 29 1255.24 1164 1280 1260.54 1202 1280 18566 18566 0.00%
crit 19.71% 3.63 0 12 2511.82 2327 2560 2451.44 0 2560 9122 9122 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 7 0.0% 0.0 0.00sec 0 0 Direct 1.0 1629 3257 1922 18.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1921.53 1921.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.02% 0.82 0 1 1628.74 1629 1629 1335.95 0 1629 1336 1336 0.00%
crit 17.98% 0.18 0 1 3257.49 3257 3257 585.58 0 3257 586 586 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 6043 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.1% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6042.83 6042.83 0.00% 51.31 51.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 72.53 60 84 56.22 43 60 56.22 55 58 4078 4078 0.00%
crit 19.41% 17.47 6 30 112.50 86 120 112.49 100 120 1965 1965 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 657 3.7% 5.9 49.51sec 33263 9316 Periodic 117.5 1402 2804 1671 19.2% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.91 0.00 23.51 117.55 3.5708 0.8340 196503.89 196503.89 0.00% 9315.63 9315.63
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.79% 94.97 69 124 1402.14 1372 1510 1401.72 1388 1418 133166 133166 0.00%
crit 19.21% 22.58 8 42 2804.42 2745 3019 2803.66 2745 2882 63337 63337 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.91
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1120) 0.0% (6.3%) 6.6 49.21sec 50971 39014

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.56 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 39013.95 39013.95

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.59
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1120 6.3% 6.6 49.04sec 50971 0 Direct 32.6 10269 0 10269 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.56 32.57 0.00 0.00 0.0000 0.0000 334115.43 334115.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.57 25 40 10269.15 2616 47407 10280.24 8462 13178 334115 334115 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5848.98
  • base_dd_max:5848.98
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Koraylon
Arcane Power 3.5 97.23sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.67sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.3 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.26 0.00 1.56 0.00 4.2796 0.7215 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.26
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.48sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.46
  • if_expr:buff.arcane_power.up
Rune of Power 6.3 47.93sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.35 0.00 0.00 0.00 1.2592 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.38
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.65sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.79
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 54.8 176.6 5.5sec 1.3sec 4.2sec 76.31% 0.00% 31.1 (33.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 9.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:21.33%
  • arcane_charge_2:18.93%
  • arcane_charge_3:14.47%
  • arcane_charge_4:21.57%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.5 0.0 97.2sec 97.2sec 14.7sec 17.45% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 111.5s
  • trigger_min/max:96.0s / 111.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.45%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.14% 23.70% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.6s / 199.2s
  • trigger_min/max:192.6s / 199.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.14%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.4 0.2 12.9sec 12.8sec 2.2sec 16.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.16%
  • clearcasting_2:0.20%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.3 0.0 0.0sec 0.0sec 4.3sec 0.38% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:0.39%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.3sec 11.18% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 306.1s
  • trigger_min/max:300.0s / 306.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.18%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.9 0.0 31.5sec 31.5sec 14.6sec 48.41% 0.00% 0.0 (0.0) 9.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.7s
  • trigger_min/max:16.8s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.41%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.60% 0.77% 4.91% 0.9s 0.0s 3.9s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000202.911144.053263.917
Evocation221.34984.123353.927284.212168.123359.855
Rune of Power14.2050.01757.50493.40876.467111.593
Touch of the Magi10.8910.00017.37273.70755.64092.758
Arcane Power1.2430.0046.0784.4211.9728.875
Arcane Barrage3.0390.00012.223165.543132.442202.292
Arcane Orb4.5970.00012.51864.05042.40682.758
Shifting Power9.3910.00038.46055.57850.268117.641

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Koraylon
mana_regen Mana 682.86 371198.87 69.50% 543.60 7115.48 1.88%
Evocation Mana 12.44 12511.95 2.34% 1005.86 0.00 0.00%
Mana Gem Mana 2.78 17644.71 3.30% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.06 132753.12 24.86% 2455.53 4288.51 3.13%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1786.73 1886.12 11412.3 33662.6 542.4 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Koraylon
arcane_explosion Mana 142.0 525452.1 3700.5 3700.4 4.5
arcane_orb Mana 13.8 6154.0 445.5 445.6 73.7
shifting_power Mana 5.9 14772.7 2500.0 2500.6 13.3
touch_of_the_magi Mana 6.6 16404.7 2500.0 2502.6 20.4

Statistics & Data Analysis

Fight Length
NightFae_Koraylon Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
NightFae_Koraylon Damage Per Second
Count 1018
Mean 17870.31
Minimum 16852.78
Maximum 19021.55
Spread ( max - min ) 2168.77
Range [ ( max - min ) / 2 * 100% ] 6.07%
Standard Deviation 366.7708
5th Percentile 17280.27
95th Percentile 18482.75
( 95th Percentile - 5th Percentile ) 1202.48
Mean Distribution
Standard Deviation 11.4953
95.00% Confidence Interval ( 17847.78 - 17892.84 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1619
0.1 Scale Factor Error with Delta=300 1149
0.05 Scale Factor Error with Delta=300 4594
0.01 Scale Factor Error with Delta=300 114835
Priority Target DPS
NightFae_Koraylon Priority Target Damage Per Second
Count 1018
Mean 4861.06
Minimum 4419.28
Maximum 5475.61
Spread ( max - min ) 1056.33
Range [ ( max - min ) / 2 * 100% ] 10.87%
Standard Deviation 167.5934
5th Percentile 4600.60
95th Percentile 5146.60
( 95th Percentile - 5th Percentile ) 546.00
Mean Distribution
Standard Deviation 5.2527
95.00% Confidence Interval ( 4850.76 - 4871.35 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4567
0.1 Scale Factor Error with Delta=300 240
0.05 Scale Factor Error with Delta=300 960
0.01 Scale Factor Error with Delta=300 23978
DPS(e)
NightFae_Koraylon Damage Per Second (Effective)
Count 1018
Mean 17870.31
Minimum 16852.78
Maximum 19021.55
Spread ( max - min ) 2168.77
Range [ ( max - min ) / 2 * 100% ] 6.07%
Damage
NightFae_Koraylon Damage
Count 1018
Mean 5328911.83
Minimum 4241650.17
Maximum 6454504.47
Spread ( max - min ) 2212854.30
Range [ ( max - min ) / 2 * 100% ] 20.76%
DTPS
NightFae_Koraylon Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Koraylon Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Koraylon Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Koraylon Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Koraylon Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Koraylon Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_KoraylonTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Koraylon Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.59 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.38 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.81 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.91 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.00 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.06 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.26 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.79 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.46 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooropmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmproooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpooooporooopmp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Koraylon 63371.4/63371: 100% mana
Pre precombat R food NightFae_Koraylon 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4)
0:01.307 shared_cds s potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.307 shared_cds t berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.307 aoe p arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.220 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.135 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.051 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.965 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.880 aoe o arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:06.795 aoe o arcane_explosion Fluffy_Pillow 61849.3/63371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.711 aoe p arcane_barrage Fluffy_Pillow 60510.2/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.627 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.540 aoe o arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.454 aoe o arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.369 aoe o arcane_explosion Fluffy_Pillow 59346.7/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.284 aoe p arcane_barrage Fluffy_Pillow 58006.4/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.198 aoe o arcane_explosion Fluffy_Pillow 61699.7/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.112 aoe o arcane_explosion Fluffy_Pillow 60358.1/63371: 95% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.120 aoe o arcane_explosion Fluffy_Pillow 59135.7/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.128 aoe o arcane_explosion Fluffy_Pillow 57913.3/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:17.134 aoe l rune_of_power Fluffy_Pillow 59188.3/63371: 93% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.141 aoe p arcane_barrage Fluffy_Pillow 60464.6/63371: 95% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.148 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.155 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.161 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.165 shared_cds r use_mana_gem NightFae_Koraylon 52195.3/63371: 82% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, potion_of_deathly_fixation
0:22.165 aoe o arcane_explosion Fluffy_Pillow 58532.4/63371: 92% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, potion_of_deathly_fixation
0:23.170 aoe p arcane_barrage Fluffy_Pillow 59806.2/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.176 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.182 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.191 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.198 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.205 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:29.212 aoe o arcane_explosion Fluffy_Pillow 52200.3/63371: 82% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power
0:30.219 aoe p arcane_barrage Fluffy_Pillow 53476.6/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power
0:31.227 aoe o arcane_explosion Fluffy_Pillow 57289.1/63371: 90% mana bloodlust, rune_of_power
0:32.234 aoe o arcane_explosion Fluffy_Pillow 53565.4/63371: 85% mana bloodlust, arcane_charge, clearcasting, rune_of_power
0:33.241 aoe n shifting_power Fluffy_Pillow 54841.7/63371: 87% mana bloodlust, arcane_charge(2)
0:36.242 aoe o arcane_explosion Fluffy_Pillow 56145.2/63371: 89% mana bloodlust, arcane_charge(2)
0:37.250 aoe o arcane_explosion Fluffy_Pillow 52422.8/63371: 83% mana bloodlust, arcane_charge(3)
0:38.257 aoe p arcane_barrage Fluffy_Pillow 48699.1/63371: 77% mana bloodlust, arcane_charge(4)
0:39.266 aoe m arcane_orb Fluffy_Pillow 52512.8/63371: 83% mana bloodlust
0:40.274 aoe p arcane_barrage Fluffy_Pillow 53290.3/63371: 84% mana bloodlust, arcane_charge(4)
0:41.280 aoe o arcane_explosion Fluffy_Pillow 57100.2/63371: 90% mana
0:42.586 aoe o arcane_explosion Fluffy_Pillow 53755.5/63371: 85% mana arcane_charge, clearcasting
0:43.893 aoe o arcane_explosion Fluffy_Pillow 55412.0/63371: 87% mana arcane_charge(2)
0:45.201 aoe o arcane_explosion Fluffy_Pillow 52069.8/63371: 82% mana arcane_charge(3)
0:46.507 aoe p arcane_barrage Fluffy_Pillow 48725.1/63371: 77% mana arcane_charge(4)
0:47.814 aoe o arcane_explosion Fluffy_Pillow 52916.5/63371: 84% mana
0:49.121 aoe o arcane_explosion Fluffy_Pillow 49573.0/63371: 78% mana arcane_charge
0:50.425 aoe j touch_of_the_magi Fluffy_Pillow 46225.7/63371: 73% mana arcane_charge(2)
0:51.730 aoe l rune_of_power Fluffy_Pillow 45379.7/63371: 72% mana arcane_charge(4), clearcasting
0:53.038 aoe p arcane_barrage Fluffy_Pillow 47037.5/63371: 74% mana arcane_charge(4), clearcasting, rune_of_power
0:54.344 aoe o arcane_explosion Fluffy_Pillow 51227.6/63371: 81% mana clearcasting, rune_of_power
0:55.651 aoe o arcane_explosion Fluffy_Pillow 52884.2/63371: 83% mana arcane_charge, rune_of_power
0:56.958 aoe o arcane_explosion Fluffy_Pillow 49540.7/63371: 78% mana arcane_charge(2), clearcasting, rune_of_power
0:58.263 aoe o arcane_explosion Fluffy_Pillow 51194.7/63371: 81% mana arcane_charge(3), rune_of_power
0:59.571 aoe p arcane_barrage Fluffy_Pillow 47852.5/63371: 76% mana arcane_charge(4), rune_of_power
1:00.877 aoe m arcane_orb Fluffy_Pillow 52042.6/63371: 82% mana rune_of_power
1:02.184 aoe p arcane_barrage Fluffy_Pillow 53199.1/63371: 84% mana arcane_charge(4), rune_of_power
1:03.491 aoe o arcane_explosion Fluffy_Pillow 57390.5/63371: 91% mana rune_of_power
1:04.798 aoe o arcane_explosion Fluffy_Pillow 54047.0/63371: 85% mana arcane_charge, rune_of_power
1:06.105 aoe o arcane_explosion Fluffy_Pillow 50703.6/63371: 80% mana arcane_charge(2), rune_of_power
1:07.411 aoe o arcane_explosion Fluffy_Pillow 47358.8/63371: 75% mana arcane_charge(3), rune_of_power
1:08.717 aoe p arcane_barrage Fluffy_Pillow 44014.1/63371: 69% mana arcane_charge(4)
1:10.023 aoe o arcane_explosion Fluffy_Pillow 48204.2/63371: 76% mana
1:11.330 aoe o arcane_explosion Fluffy_Pillow 44860.7/63371: 71% mana arcane_charge
1:12.635 aoe o arcane_explosion Fluffy_Pillow 41514.7/63371: 66% mana arcane_charge(2)
1:13.941 aoe o arcane_explosion Fluffy_Pillow 38170.0/63371: 60% mana arcane_charge(3)
1:15.247 aoe p arcane_barrage Fluffy_Pillow 34825.3/63371: 55% mana arcane_charge(4)
1:16.554 aoe o arcane_explosion Fluffy_Pillow 39016.6/63371: 62% mana
1:17.860 aoe o arcane_explosion Fluffy_Pillow 35671.9/63371: 56% mana arcane_charge
1:19.167 aoe n shifting_power Fluffy_Pillow 32328.4/63371: 51% mana arcane_charge(2), clearcasting
1:22.921 aoe o arcane_explosion Fluffy_Pillow 34586.4/63371: 55% mana arcane_charge(2), clearcasting
1:24.227 aoe o arcane_explosion Fluffy_Pillow 36241.6/63371: 57% mana arcane_charge(3)
1:25.533 aoe p arcane_barrage Fluffy_Pillow 32896.9/63371: 52% mana arcane_charge(4)
1:26.839 aoe m arcane_orb Fluffy_Pillow 37087.0/63371: 59% mana
1:28.144 aoe p arcane_barrage Fluffy_Pillow 38241.0/63371: 60% mana arcane_charge(4)
1:29.450 aoe o arcane_explosion Fluffy_Pillow 42431.1/63371: 67% mana
1:30.757 aoe o arcane_explosion Fluffy_Pillow 39087.7/63371: 62% mana arcane_charge
1:32.063 aoe o arcane_explosion Fluffy_Pillow 35742.9/63371: 56% mana arcane_charge(2)
1:33.369 aoe o arcane_explosion Fluffy_Pillow 32398.2/63371: 51% mana arcane_charge(3)
1:34.675 aoe p arcane_barrage Fluffy_Pillow 29053.4/63371: 46% mana arcane_charge(4)
1:35.981 aoe o arcane_explosion Fluffy_Pillow 33243.6/63371: 52% mana
1:37.287 aoe j touch_of_the_magi Fluffy_Pillow 29898.8/63371: 47% mana arcane_charge
1:38.592 aoe k arcane_power Fluffy_Pillow 29052.8/63371: 46% mana arcane_charge(4)
1:38.592 aoe p arcane_barrage Fluffy_Pillow 29052.8/63371: 46% mana arcane_charge(4), arcane_power, rune_of_power
1:39.899 aoe o arcane_explosion Fluffy_Pillow 33244.2/63371: 52% mana arcane_power, rune_of_power
1:41.205 aoe o arcane_explosion Fluffy_Pillow 32399.5/63371: 51% mana arcane_charge, arcane_power, rune_of_power
1:42.513 aoe o arcane_explosion Fluffy_Pillow 31557.3/63371: 50% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power
1:43.818 aoe o arcane_explosion Fluffy_Pillow 33211.2/63371: 52% mana arcane_charge(3), arcane_power, rune_of_power
1:45.124 aoe p arcane_barrage Fluffy_Pillow 32366.5/63371: 51% mana arcane_charge(4), arcane_power, rune_of_power
1:46.432 aoe o arcane_explosion Fluffy_Pillow 36559.2/63371: 58% mana arcane_power, rune_of_power
1:47.737 aoe o arcane_explosion Fluffy_Pillow 35713.2/63371: 56% mana arcane_charge, arcane_power, rune_of_power
1:49.043 aoe o arcane_explosion Fluffy_Pillow 34868.4/63371: 55% mana arcane_charge(2), arcane_power, rune_of_power
1:50.349 aoe o arcane_explosion Fluffy_Pillow 34023.7/63371: 54% mana arcane_charge(3), arcane_power, rune_of_power
1:51.656 aoe p arcane_barrage Fluffy_Pillow 33180.2/63371: 52% mana arcane_charge(4), arcane_power, rune_of_power
1:52.961 aoe m arcane_orb Fluffy_Pillow 37369.1/63371: 59% mana arcane_power, rune_of_power
1:54.269 aoe l rune_of_power Fluffy_Pillow 38776.9/63371: 61% mana arcane_charge(4)
1:55.577 aoe p arcane_barrage Fluffy_Pillow 40434.7/63371: 64% mana arcane_charge(4), rune_of_power
1:56.886 aoe o arcane_explosion Fluffy_Pillow 44628.6/63371: 70% mana rune_of_power
1:58.194 aoe o arcane_explosion Fluffy_Pillow 41286.4/63371: 65% mana arcane_charge, rune_of_power
1:59.501 aoe o arcane_explosion Fluffy_Pillow 37942.9/63371: 60% mana arcane_charge(2), clearcasting, rune_of_power
2:00.807 aoe o arcane_explosion Fluffy_Pillow 39598.2/63371: 62% mana arcane_charge(3), rune_of_power
2:02.114 aoe p arcane_barrage Fluffy_Pillow 36254.7/63371: 57% mana arcane_charge(4), rune_of_power
2:03.421 aoe o arcane_explosion Fluffy_Pillow 40446.1/63371: 64% mana rune_of_power
2:04.729 aoe o arcane_explosion Fluffy_Pillow 37103.9/63371: 59% mana arcane_charge, rune_of_power
2:06.035 aoe o arcane_explosion Fluffy_Pillow 33759.1/63371: 53% mana arcane_charge(2), rune_of_power
2:07.342 aoe o arcane_explosion Fluffy_Pillow 30415.7/63371: 48% mana arcane_charge(3), rune_of_power
2:08.648 aoe p arcane_barrage Fluffy_Pillow 27070.9/63371: 43% mana arcane_charge(4), rune_of_power
2:09.954 aoe o arcane_explosion Fluffy_Pillow 31261.0/63371: 49% mana rune_of_power
2:11.261 aoe n shifting_power Fluffy_Pillow 27917.6/63371: 44% mana arcane_charge, clearcasting
2:15.008 aoe o arcane_explosion Fluffy_Pillow 30166.6/63371: 48% mana arcane_charge, clearcasting
2:16.315 aoe o arcane_explosion Fluffy_Pillow 31823.2/63371: 50% mana arcane_charge(2)
2:17.621 aoe o arcane_explosion Fluffy_Pillow 28478.4/63371: 45% mana arcane_charge(3)
2:18.926 aoe p arcane_barrage Fluffy_Pillow 25132.4/63371: 40% mana arcane_charge(4)
2:20.234 aoe m arcane_orb Fluffy_Pillow 29325.1/63371: 46% mana
2:21.539 aoe p arcane_barrage Fluffy_Pillow 30479.1/63371: 48% mana arcane_charge(4)
2:22.845 shared_cds r use_mana_gem NightFae_Koraylon 34669.2/63371: 55% mana
2:22.845 aoe o arcane_explosion Fluffy_Pillow 41006.3/63371: 65% mana
2:24.152 aoe o arcane_explosion Fluffy_Pillow 37662.9/63371: 59% mana arcane_charge
2:25.457 aoe o arcane_explosion Fluffy_Pillow 34316.9/63371: 54% mana arcane_charge(2)
2:26.764 aoe o arcane_explosion Fluffy_Pillow 30973.4/63371: 49% mana arcane_charge(3)
2:28.071 aoe p arcane_barrage Fluffy_Pillow 27629.9/63371: 44% mana arcane_charge(4), clearcasting
2:29.379 aoe j touch_of_the_magi Fluffy_Pillow 31822.6/63371: 50% mana clearcasting
2:30.687 aoe l rune_of_power Fluffy_Pillow 30980.4/63371: 49% mana arcane_charge(4), clearcasting
2:31.993 aoe p arcane_barrage Fluffy_Pillow 32635.6/63371: 51% mana arcane_charge(4), clearcasting, rune_of_power
2:33.301 aoe o arcane_explosion Fluffy_Pillow 36828.3/63371: 58% mana clearcasting, rune_of_power
2:34.605 aoe o arcane_explosion Fluffy_Pillow 38481.0/63371: 61% mana arcane_charge, rune_of_power
2:35.911 aoe o arcane_explosion Fluffy_Pillow 35136.3/63371: 55% mana arcane_charge(2), clearcasting, rune_of_power
2:37.218 aoe o arcane_explosion Fluffy_Pillow 36792.8/63371: 58% mana arcane_charge(3), rune_of_power
2:38.524 aoe p arcane_barrage Fluffy_Pillow 33448.1/63371: 53% mana arcane_charge(4), rune_of_power
2:39.829 aoe o arcane_explosion Fluffy_Pillow 37636.9/63371: 59% mana rune_of_power
2:41.137 aoe o arcane_explosion Fluffy_Pillow 34294.7/63371: 54% mana arcane_charge, clearcasting, rune_of_power
2:42.444 aoe o arcane_explosion Fluffy_Pillow 35951.2/63371: 57% mana arcane_charge(2), rune_of_power
2:43.749 aoe o arcane_explosion Fluffy_Pillow 32605.2/63371: 51% mana arcane_charge(3), rune_of_power
2:45.056 aoe p arcane_barrage Fluffy_Pillow 29261.8/63371: 46% mana arcane_charge(4), rune_of_power
2:46.364 aoe m arcane_orb Fluffy_Pillow 33454.4/63371: 53% mana rune_of_power
2:47.672 aoe p arcane_barrage Fluffy_Pillow 34612.2/63371: 55% mana arcane_charge(4)
2:48.978 aoe o arcane_explosion Fluffy_Pillow 38802.3/63371: 61% mana
2:50.286 aoe o arcane_explosion Fluffy_Pillow 35460.1/63371: 56% mana arcane_charge, clearcasting
2:51.592 aoe o arcane_explosion Fluffy_Pillow 37115.4/63371: 59% mana arcane_charge(2)
2:52.898 aoe o arcane_explosion Fluffy_Pillow 33770.6/63371: 53% mana arcane_charge(3)
2:54.204 aoe p arcane_barrage Fluffy_Pillow 30425.9/63371: 48% mana arcane_charge(4)
2:55.512 aoe o arcane_explosion Fluffy_Pillow 34618.6/63371: 55% mana
2:56.819 aoe n shifting_power Fluffy_Pillow 31275.1/63371: 49% mana arcane_charge
3:00.603 aoe o arcane_explosion Fluffy_Pillow 33571.0/63371: 53% mana arcane_charge
3:01.909 aoe o arcane_explosion Fluffy_Pillow 30226.3/63371: 48% mana arcane_charge(2)
3:03.217 aoe o arcane_explosion Fluffy_Pillow 26884.1/63371: 42% mana arcane_charge(3)
3:04.524 aoe p arcane_barrage Fluffy_Pillow 23540.6/63371: 37% mana arcane_charge(4), clearcasting
3:05.831 aoe m arcane_orb Fluffy_Pillow 27732.0/63371: 44% mana clearcasting
3:07.136 aoe p arcane_barrage Fluffy_Pillow 28886.0/63371: 46% mana arcane_charge(4), clearcasting
3:08.444 aoe o arcane_explosion Fluffy_Pillow 33078.7/63371: 52% mana clearcasting
3:09.750 aoe o arcane_explosion Fluffy_Pillow 34733.9/63371: 55% mana arcane_charge
3:11.054 aoe o arcane_explosion Fluffy_Pillow 31386.6/63371: 50% mana arcane_charge(2)
3:12.361 aoe o arcane_explosion Fluffy_Pillow 28043.2/63371: 44% mana arcane_charge(3)
3:13.665 aoe p arcane_barrage Fluffy_Pillow 24695.9/63371: 39% mana arcane_charge(4)
3:14.972 aoe j touch_of_the_magi Fluffy_Pillow 28887.3/63371: 46% mana
3:16.278 aoe k arcane_power Fluffy_Pillow 28042.6/63371: 44% mana arcane_charge(4)
3:16.278 shared_cds t berserking Fluffy_Pillow 28042.6/63371: 44% mana arcane_charge(4), arcane_power, rune_of_power
3:16.278 aoe p arcane_barrage Fluffy_Pillow 28042.6/63371: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.467 aoe o arcane_explosion Fluffy_Pillow 32084.4/63371: 51% mana berserking, arcane_power, rune_of_power
3:18.657 aoe o arcane_explosion Fluffy_Pillow 31092.6/63371: 49% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.847 aoe o arcane_explosion Fluffy_Pillow 30100.9/63371: 47% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:21.034 aoe o arcane_explosion Fluffy_Pillow 29105.3/63371: 46% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:22.222 aoe p arcane_barrage Fluffy_Pillow 28111.0/63371: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.412 aoe o arcane_explosion Fluffy_Pillow 32154.1/63371: 51% mana berserking, arcane_power, rune_of_power
3:24.600 aoe o arcane_explosion Fluffy_Pillow 31159.8/63371: 49% mana berserking, arcane_charge, arcane_power, rune_of_power
3:25.788 aoe o arcane_explosion Fluffy_Pillow 30165.5/63371: 48% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:26.976 aoe o arcane_explosion Fluffy_Pillow 29171.2/63371: 46% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:28.165 aoe p arcane_barrage Fluffy_Pillow 28178.2/63371: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:29.354 aoe m arcane_orb Fluffy_Pillow 32220.0/63371: 51% mana arcane_power, rune_of_power
3:30.661 aoe p arcane_barrage Fluffy_Pillow 33626.5/63371: 53% mana arcane_charge(4), arcane_power, rune_of_power
3:32.063 aoe o arcane_explosion Fluffy_Pillow 37938.3/63371: 60% mana
3:33.369 aoe o arcane_explosion Fluffy_Pillow 34593.6/63371: 55% mana arcane_charge
3:34.675 aoe o arcane_explosion Fluffy_Pillow 31248.9/63371: 49% mana arcane_charge(2), clearcasting
3:35.982 aoe o arcane_explosion Fluffy_Pillow 32905.4/63371: 52% mana arcane_charge(3)
3:37.288 aoe l rune_of_power Fluffy_Pillow 29560.7/63371: 47% mana arcane_charge(4)
3:38.596 aoe p arcane_barrage Fluffy_Pillow 31218.5/63371: 49% mana arcane_charge(4), rune_of_power
3:39.902 aoe o arcane_explosion Fluffy_Pillow 35408.6/63371: 56% mana rune_of_power
3:41.209 aoe o arcane_explosion Fluffy_Pillow 32065.1/63371: 51% mana arcane_charge, rune_of_power
3:42.514 aoe o arcane_explosion Fluffy_Pillow 28719.1/63371: 45% mana arcane_charge(2), rune_of_power
3:43.821 aoe o arcane_explosion Fluffy_Pillow 25375.6/63371: 40% mana arcane_charge(3), rune_of_power
3:45.128 aoe p arcane_barrage Fluffy_Pillow 22032.2/63371: 35% mana arcane_charge(4), rune_of_power
3:46.433 aoe o arcane_explosion Fluffy_Pillow 26221.0/63371: 41% mana rune_of_power
3:47.739 aoe o arcane_explosion Fluffy_Pillow 22876.3/63371: 36% mana arcane_charge, rune_of_power
3:49.045 aoe o arcane_explosion Fluffy_Pillow 19531.5/63371: 31% mana arcane_charge(2), rune_of_power
3:50.351 aoe o arcane_explosion Fluffy_Pillow 16186.8/63371: 26% mana arcane_charge(3), rune_of_power
3:51.656 aoe p arcane_barrage Fluffy_Pillow 12840.8/63371: 20% mana arcane_charge(4), rune_of_power
3:52.962 aoe m arcane_orb Fluffy_Pillow 17030.9/63371: 27% mana rune_of_power
3:54.267 aoe n shifting_power Fluffy_Pillow 18184.9/63371: 29% mana arcane_charge(4)
3:57.949 aoe p arcane_barrage Fluffy_Pillow 20351.6/63371: 32% mana arcane_charge(4), clearcasting
3:59.257 aoe o arcane_explosion Fluffy_Pillow 24544.2/63371: 39% mana clearcasting
4:00.564 aoe o arcane_explosion Fluffy_Pillow 26200.8/63371: 41% mana arcane_charge
4:01.868 aoe o arcane_explosion Fluffy_Pillow 22853.5/63371: 36% mana arcane_charge(2)
4:03.174 aoe o arcane_explosion Fluffy_Pillow 19508.7/63371: 31% mana arcane_charge(3)
4:04.479 aoe p arcane_barrage Fluffy_Pillow 16162.7/63371: 26% mana arcane_charge(4)
4:05.786 aoe m arcane_orb Fluffy_Pillow 20354.1/63371: 32% mana
4:07.093 aoe p arcane_barrage Fluffy_Pillow 21510.6/63371: 34% mana arcane_charge(4)
4:08.400 aoe o arcane_explosion Fluffy_Pillow 25702.0/63371: 41% mana
4:09.705 aoe o arcane_explosion Fluffy_Pillow 22356.0/63371: 35% mana arcane_charge, clearcasting
4:11.011 aoe j touch_of_the_magi Fluffy_Pillow 24011.3/63371: 38% mana arcane_charge(2)
4:12.318 aoe l rune_of_power Fluffy_Pillow 23167.8/63371: 37% mana arcane_charge(4)
4:13.624 aoe p arcane_barrage Fluffy_Pillow 24823.1/63371: 39% mana arcane_charge(4), rune_of_power
4:14.932 aoe o arcane_explosion Fluffy_Pillow 29015.7/63371: 46% mana rune_of_power
4:16.238 aoe o arcane_explosion Fluffy_Pillow 25671.0/63371: 41% mana arcane_charge, rune_of_power
4:17.544 aoe o arcane_explosion Fluffy_Pillow 22326.3/63371: 35% mana arcane_charge(2), clearcasting, rune_of_power
4:18.851 aoe o arcane_explosion Fluffy_Pillow 23982.8/63371: 38% mana arcane_charge(3), rune_of_power
4:20.157 aoe p arcane_barrage Fluffy_Pillow 20638.1/63371: 33% mana arcane_charge(4), clearcasting, rune_of_power
4:21.463 aoe o arcane_explosion Fluffy_Pillow 24828.2/63371: 39% mana clearcasting, rune_of_power
4:22.769 shared_cds r use_mana_gem NightFae_Koraylon 26483.4/63371: 42% mana arcane_charge, rune_of_power
4:22.845 aoe o arcane_explosion Fluffy_Pillow 32916.9/63371: 52% mana arcane_charge, rune_of_power
4:24.151 aoe o arcane_explosion Fluffy_Pillow 29572.2/63371: 47% mana arcane_charge(2), rune_of_power
4:25.457 aoe o arcane_explosion Fluffy_Pillow 26227.4/63371: 41% mana arcane_charge(3), clearcasting, rune_of_power
4:26.763 aoe p arcane_barrage Fluffy_Pillow 27882.7/63371: 44% mana arcane_charge(4), rune_of_power
4:28.072 aoe m arcane_orb Fluffy_Pillow 32076.6/63371: 51% mana rune_of_power
4:29.379 aoe p arcane_barrage Fluffy_Pillow 33233.1/63371: 52% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Koraylon"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=325066//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Niya : 17759 dps, 4830 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17759.4 17759.4 20.9 / 0.118% 1320.1 / 7.4% 9.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
1891.6 1807.0 Mana 0.00% 48.0 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 17759
Arcane Barrage 5940 33.4% 54.2 5.53sec 32701 26418 Direct 270.7 5494 10991 6554 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.21 270.67 0.00 0.00 1.2378 0.0000 1772780.08 1772780.08 0.00% 26418.00 26418.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 218.54 162 279 5494.25 2082 26188 5496.97 5062 5990 1200196 1200196 0.00%
crit 19.26% 52.13 28 78 10991.01 4164 52376 10986.51 7751 14425 572584 572584 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.22
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 482 2.7% 41.2 6.91sec 3494 0 Direct 206.1 586 1171 699 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.23 206.14 0.00 0.00 0.0000 0.0000 144036.39 144036.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 166.37 122 219 586.01 443 664 585.96 567 606 97482 97482 0.00%
crit 19.29% 39.77 19 67 1170.53 886 1329 1170.24 1043 1266 46554 46554 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7960 44.8% 142.5 2.07sec 16692 13423 Direct 712.3 2798 5592 3338 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.46 712.32 0.00 0.00 1.2435 0.0000 2378009.24 2378009.24 0.00% 13423.17 13423.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 574.51 446 702 2797.58 1958 4400 2797.04 2709 2873 1607256 1607256 0.00%
crit 19.35% 137.81 93 195 5591.78 3916 8800 5591.68 5139 6010 770753 770753 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.45
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1513) 0.0% (8.5%) 13.9 22.19sec 32516 26328

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.88 0.00 0.00 0.00 1.2350 0.0000 0.00 0.00 0.00% 26328.23 26328.23

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.88
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1513 8.5% 69.3 22.19sec 6511 0 Direct 69.3 5442 10900 6510 19.6%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.33 69.33 0.00 0.00 0.0000 0.0000 451450.13 451450.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.41% 55.75 40 74 5441.51 3869 8553 5452.39 5011 5902 303412 303412 0.00%
crit 19.59% 13.58 2 28 10899.60 7739 17106 10918.75 8100 14664 148038 148038 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (0.5%) 18.4 8.92sec 1389 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.45 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 0.5% 18.4 8.92sec 1389 0 Direct 18.4 1164 2327 1389 19.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.45 18.45 0.00 0.00 0.0000 0.0000 25622.83 25622.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 14.88 4 31 1163.53 1164 1164 1163.53 1164 1164 17309 17309 0.00%
crit 19.37% 3.57 0 13 2327.06 2327 2327 2226.48 0 2327 8314 8314 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1780 20.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1780.30 1780.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.76% 0.80 0 1 1480.68 1481 1481 1181.05 0 1481 1181 1181 0.00%
crit 20.24% 0.20 0 1 2961.35 2961 2961 599.25 0 2961 599 599 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.1%) 1.0 0.00sec 6048 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 21 0.1% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6047.95 6047.95 0.00% 51.35 51.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 72.42 59 82 56.23 43 60 56.23 55 58 4073 4073 0.00%
crit 19.53% 17.58 8 31 112.39 86 120 112.38 102 120 1975 1975 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 643 3.6% 5.9 49.52sec 32555 9124 Periodic 117.5 1372 2745 1637 19.3% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.91 0.00 23.50 117.51 3.5682 0.8340 192357.44 192357.44 0.00% 9123.82 9123.82
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 94.85 71 123 1372.31 1372 1372 1372.31 1372 1372 130162 130162 0.00%
crit 19.28% 22.66 9 39 2744.61 2745 2745 2744.61 2745 2745 62196 62196 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.91
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1109) 0.0% (6.2%) 6.6 49.17sec 50500 38656

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.56 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 38656.33 38656.33

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.59
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1109 6.2% 6.6 49.01sec 50500 0 Direct 32.6 10174 0 10174 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.56 32.59 0.00 0.00 0.0000 0.0000 331130.10 331130.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.59 25 40 10174.00 2669 49022 10175.85 8522 12959 331130 331130 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11784.88
  • base_dd_max:11784.88
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Niya
Arcane Power 3.6 97.16sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.68sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.0 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.05 0.00 0.29 0.00 4.3445 0.7233 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.05
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.36sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.46
  • if_expr:buff.arcane_power.up
Rune of Power 6.3 47.94sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.34 0.00 0.00 0.00 1.2592 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.38
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.77sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.79
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.0 177.3 5.5sec 1.3sec 4.1sec 76.24% 0.00% 31.2 (33.2) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:21.30%
  • arcane_charge_2:18.98%
  • arcane_charge_3:14.24%
  • arcane_charge_4:21.72%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.46% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.0s
  • trigger_min/max:96.0s / 102.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.46%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.14% 23.70% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:193.4s / 199.1s
  • trigger_min/max:193.4s / 199.1s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.14%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.3 12.8sec 12.7sec 2.2sec 16.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.13%
  • clearcasting_2:0.24%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.0 0.0 0.0sec 0.0sec 4.3sec 0.07% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:4.3s / 4.3s

Stack Uptimes

  • evocation_1:0.10%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.4sec 300.4sec 23.2sec 11.19% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.19%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Redirected Anima 16.6 0.0 52.0sec 17.0sec 65.8sec 84.08% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.5s / 320.4s
  • trigger_min/max:0.3s / 57.9s
  • trigger_pct:98.58%
  • duration_min/max:0.4s / 311.2s

Stack Uptimes

  • redirected_anima_1:17.40%
  • redirected_anima_2:7.89%
  • redirected_anima_3:2.33%
  • redirected_anima_4:0.49%
  • redirected_anima_5:0.09%
  • redirected_anima_6:16.42%
  • redirected_anima_7:23.23%
  • redirected_anima_8:11.49%
  • redirected_anima_9:3.79%
  • redirected_anima_10:0.79%
  • redirected_anima_11:0.17%
  • redirected_anima_12:0.04%
  • redirected_anima_13:0.00%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.9 0.0 31.5sec 31.5sec 14.6sec 48.42% 0.00% 0.0 (0.0) 9.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.6s
  • trigger_min/max:16.8s / 48.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.42%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.56% 0.76% 6.33% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000202.911144.053263.917
Evocation237.513137.517352.487296.658182.996359.661
Rune of Power14.2190.01636.50793.49076.575108.542
Touch of the Magi10.8730.00016.75573.58457.20691.482
Arcane Power1.2080.0045.9504.2982.7638.357
Arcane Barrage3.0220.00012.118165.121132.440202.133
Arcane Orb4.5590.00012.50063.83543.30279.309
Shifting Power9.3950.00033.25355.61950.47162.372

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
mana_regen Mana 704.79 382534.67 70.81% 542.77 7060.15 1.81%
Evocation Mana 2.43 2486.37 0.46% 1023.04 0.00 0.00%
Mana Gem Mana 2.79 18225.53 3.37% 6529.87 0.00 0.00%
Arcane Barrage Mana 54.22 137009.46 25.36% 2526.85 4349.22 3.08%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1806.98 1891.59 11405.0 36999.7 1391.7 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Niya
arcane_explosion Mana 142.5 527060.0 3699.9 3699.6 4.5
arcane_orb Mana 13.9 6190.8 445.9 445.9 72.9
shifting_power Mana 5.9 14775.1 2500.0 2500.6 13.0
touch_of_the_magi Mana 6.6 16409.6 2500.0 2502.6 20.2

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
NightFae_Niya Damage Per Second
Count 1018
Mean 17759.45
Minimum 16715.03
Maximum 18954.10
Spread ( max - min ) 2239.07
Range [ ( max - min ) / 2 * 100% ] 6.30%
Standard Deviation 340.8147
5th Percentile 17186.99
95th Percentile 18306.67
( 95th Percentile - 5th Percentile ) 1119.68
Mean Distribution
Standard Deviation 10.6818
95.00% Confidence Interval ( 17738.51 - 17780.38 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1415
0.1 Scale Factor Error with Delta=300 992
0.05 Scale Factor Error with Delta=300 3967
0.01 Scale Factor Error with Delta=300 99157
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 1018
Mean 4830.15
Minimum 4356.05
Maximum 5408.92
Spread ( max - min ) 1052.87
Range [ ( max - min ) / 2 * 100% ] 10.90%
Standard Deviation 163.4266
5th Percentile 4570.08
95th Percentile 5103.73
( 95th Percentile - 5th Percentile ) 533.65
Mean Distribution
Standard Deviation 5.1221
95.00% Confidence Interval ( 4820.11 - 4840.19 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4398
0.1 Scale Factor Error with Delta=300 228
0.05 Scale Factor Error with Delta=300 912
0.01 Scale Factor Error with Delta=300 22800
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 1018
Mean 17759.45
Minimum 16715.03
Maximum 18954.10
Spread ( max - min ) 2239.07
Range [ ( max - min ) / 2 * 100% ] 6.30%
Damage
NightFae_Niya Damage
Count 1018
Mean 5297166.53
Minimum 4234146.70
Maximum 6427292.14
Spread ( max - min ) 2193145.44
Range [ ( max - min ) / 2 * 100% ] 20.70%
DTPS
NightFae_Niya Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.59 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.38 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.88 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.91 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.45 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.22 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.05 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.79 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.46 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpooroopmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmrpoooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpooooproooopmpo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Niya 63371.4/63371: 100% mana
Pre precombat R food NightFae_Niya 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.308 aoe k arcane_power Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4)
0:01.308 shared_cds s potion Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.308 shared_cds t berserking Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.308 aoe p arcane_barrage Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.222 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.136 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.050 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.965 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.880 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.794 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.709 aoe p arcane_barrage Fluffy_Pillow 58401.3/63800: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:08.623 aoe o arcane_explosion Fluffy_Pillow 62119.5/63800: 97% mana bloodlust, berserking, arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:09.536 aoe o arcane_explosion Fluffy_Pillow 60784.5/63800: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:10.450 aoe o arcane_explosion Fluffy_Pillow 59450.8/63800: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:11.365 aoe o arcane_explosion Fluffy_Pillow 58118.3/63800: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:12.279 aoe p arcane_barrage Fluffy_Pillow 56784.6/63800: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:13.195 aoe o arcane_explosion Fluffy_Pillow 60505.4/63800: 95% mana bloodlust, berserking, arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:14.111 aoe o arcane_explosion Fluffy_Pillow 59174.2/63800: 93% mana bloodlust, arcane_charge, arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:15.117 aoe o arcane_explosion Fluffy_Pillow 57957.9/63800: 91% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:16.125 aoe o arcane_explosion Fluffy_Pillow 56744.1/63800: 89% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:17.131 aoe l rune_of_power Fluffy_Pillow 55527.7/63800: 87% mana bloodlust, arcane_charge(4), redirected_anima, potion_of_deathly_fixation
0:18.137 aoe p arcane_barrage Fluffy_Pillow 56811.4/63800: 89% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima, potion_of_deathly_fixation
0:19.144 aoe o arcane_explosion Fluffy_Pillow 60648.3/63800: 95% mana bloodlust, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:20.152 aoe o arcane_explosion Fluffy_Pillow 56934.5/63800: 89% mana bloodlust, arcane_charge, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:21.158 shared_cds r use_mana_gem NightFae_Niya 53218.2/63800: 83% mana bloodlust, arcane_charge(2), rune_of_power, redirected_anima, potion_of_deathly_fixation
0:21.158 aoe o arcane_explosion Fluffy_Pillow 59598.2/63800: 93% mana bloodlust, arcane_charge(2), rune_of_power, redirected_anima, potion_of_deathly_fixation
0:22.163 aoe o arcane_explosion Fluffy_Pillow 55880.6/63800: 88% mana bloodlust, arcane_charge(3), rune_of_power, redirected_anima, potion_of_deathly_fixation
0:23.170 aoe p arcane_barrage Fluffy_Pillow 52165.5/63800: 82% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima, potion_of_deathly_fixation
0:24.179 aoe m arcane_orb Fluffy_Pillow 56005.0/63800: 88% mana bloodlust, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:25.183 aoe p arcane_barrage Fluffy_Pillow 56786.1/63800: 89% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima, potion_of_deathly_fixation
0:26.189 aoe o arcane_explosion Fluffy_Pillow 60621.7/63800: 95% mana bloodlust, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:27.194 aoe o arcane_explosion Fluffy_Pillow 56904.1/63800: 89% mana bloodlust, arcane_charge, rune_of_power, redirected_anima
0:28.202 aoe o arcane_explosion Fluffy_Pillow 53190.3/63800: 83% mana bloodlust, arcane_charge(2), rune_of_power, redirected_anima
0:29.209 aoe o arcane_explosion Fluffy_Pillow 49475.3/63800: 78% mana bloodlust, arcane_charge(3), rune_of_power, redirected_anima
0:30.216 aoe p arcane_barrage Fluffy_Pillow 45760.2/63800: 72% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima
0:31.223 aoe o arcane_explosion Fluffy_Pillow 49597.1/63800: 78% mana bloodlust, rune_of_power, redirected_anima
0:32.230 aoe o arcane_explosion Fluffy_Pillow 46190.3/64229: 72% mana bloodlust, arcane_charge, rune_of_power, redirected_anima(2)
0:33.236 aoe n shifting_power Fluffy_Pillow 42482.5/64229: 66% mana bloodlust, arcane_charge(2), clearcasting, redirected_anima(2)
0:36.195 aoe o arcane_explosion Fluffy_Pillow 45536.5/66800: 68% mana bloodlust, arcane_charge(2), clearcasting, redirected_anima(8)
0:37.203 aoe o arcane_explosion Fluffy_Pillow 46582.4/66371: 70% mana bloodlust, arcane_charge(3), redirected_anima(7)
0:38.208 aoe p arcane_barrage Fluffy_Pillow 42916.5/66371: 65% mana bloodlust, arcane_charge(4), redirected_anima(7)
0:39.214 aoe m arcane_orb Fluffy_Pillow 46906.7/66371: 71% mana bloodlust, redirected_anima(7)
0:40.221 aoe p arcane_barrage Fluffy_Pillow 47743.4/66371: 72% mana bloodlust, arcane_charge(4), redirected_anima(7)
0:41.226 aoe o arcane_explosion Fluffy_Pillow 51732.3/66371: 78% mana redirected_anima(7)
0:42.533 aoe o arcane_explosion Fluffy_Pillow 48467.3/66371: 73% mana arcane_charge, redirected_anima(7)
0:43.841 aoe o arcane_explosion Fluffy_Pillow 45203.6/66371: 68% mana arcane_charge(2), redirected_anima(7)
0:45.147 aoe o arcane_explosion Fluffy_Pillow 41937.2/66371: 63% mana arcane_charge(3), redirected_anima(7)
0:46.456 aoe p arcane_barrage Fluffy_Pillow 38674.8/66371: 58% mana arcane_charge(4), redirected_anima(7)
0:47.761 aoe o arcane_explosion Fluffy_Pillow 43061.9/66371: 65% mana redirected_anima(7)
0:49.066 aoe o arcane_explosion Fluffy_Pillow 40051.2/66800: 60% mana arcane_charge, redirected_anima(8)
0:50.372 aoe j touch_of_the_magi Fluffy_Pillow 36796.0/66800: 55% mana arcane_charge(2), clearcasting, redirected_anima(8)
0:51.677 aoe l rune_of_power Fluffy_Pillow 36039.5/66800: 54% mana arcane_charge(4), clearcasting, redirected_anima(8)
0:52.983 aoe p arcane_barrage Fluffy_Pillow 37784.3/66800: 57% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(8)
0:54.289 aoe o arcane_explosion Fluffy_Pillow 42201.1/66800: 63% mana clearcasting, rune_of_power, redirected_anima(8)
0:55.594 aoe o arcane_explosion Fluffy_Pillow 43944.6/66800: 66% mana arcane_charge, rune_of_power, redirected_anima(8)
0:56.902 aoe o arcane_explosion Fluffy_Pillow 40953.2/67229: 61% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(9)
0:58.210 aoe o arcane_explosion Fluffy_Pillow 42711.9/67229: 64% mana arcane_charge(3), rune_of_power, redirected_anima(9)
0:59.517 aoe p arcane_barrage Fluffy_Pillow 39469.2/67229: 59% mana arcane_charge(4), rune_of_power, redirected_anima(9)
1:00.825 aoe m arcane_orb Fluffy_Pillow 43917.1/67229: 65% mana rune_of_power, redirected_anima(9)
1:02.130 aoe p arcane_barrage Fluffy_Pillow 44883.8/66800: 67% mana arcane_charge(4), rune_of_power, redirected_anima(8)
1:03.436 aoe o arcane_explosion Fluffy_Pillow 47402.8/64229: 74% mana rune_of_power, redirected_anima(2)
1:04.742 aoe o arcane_explosion Fluffy_Pillow 44374.6/64657: 69% mana arcane_charge, rune_of_power, redirected_anima(3)
1:06.050 aoe o arcane_explosion Fluffy_Pillow 41066.0/64657: 64% mana arcane_charge(2), rune_of_power, redirected_anima(3)
1:07.356 aoe o arcane_explosion Fluffy_Pillow 37754.8/64657: 58% mana arcane_charge(3), rune_of_power, redirected_anima(3)
1:08.663 aoe p arcane_barrage Fluffy_Pillow 34445.0/64657: 53% mana arcane_charge(4), redirected_anima(3)
1:09.971 aoe o arcane_explosion Fluffy_Pillow 38979.4/65086: 60% mana redirected_anima(4)
1:11.278 aoe o arcane_explosion Fluffy_Pillow 35680.7/65086: 55% mana arcane_charge, clearcasting, redirected_anima(4)
1:12.586 aoe o arcane_explosion Fluffy_Pillow 37383.3/65086: 57% mana arcane_charge(2), redirected_anima(4)
1:13.894 aoe o arcane_explosion Fluffy_Pillow 34086.0/65086: 52% mana arcane_charge(3), redirected_anima(4)
1:15.201 aoe p arcane_barrage Fluffy_Pillow 30787.3/65086: 47% mana arcane_charge(4), clearcasting, redirected_anima(4)
1:16.509 aoe o arcane_explosion Fluffy_Pillow 35093.4/65086: 54% mana clearcasting, redirected_anima(4)
1:17.816 aoe o arcane_explosion Fluffy_Pillow 36794.7/65086: 57% mana arcane_charge, redirected_anima(4)
1:19.121 aoe n shifting_power Fluffy_Pillow 33493.5/65086: 51% mana arcane_charge(2), redirected_anima(4)
1:22.904 aoe o arcane_explosion Fluffy_Pillow 37336.9/67657: 55% mana arcane_charge(2), redirected_anima(10)
1:24.212 aoe o arcane_explosion Fluffy_Pillow 34106.8/67657: 50% mana arcane_charge(3), redirected_anima(10)
1:25.519 aoe p arcane_barrage Fluffy_Pillow 30875.4/67657: 46% mana arcane_charge(4), redirected_anima(10)
1:26.825 aoe m arcane_orb Fluffy_Pillow 35125.0/67229: 52% mana redirected_anima(9)
1:28.130 aoe p arcane_barrage Fluffy_Pillow 36379.6/67229: 54% mana arcane_charge(4), redirected_anima(9)
1:29.436 aoe o arcane_explosion Fluffy_Pillow 40824.8/67229: 61% mana redirected_anima(9)
1:30.741 aoe o arcane_explosion Fluffy_Pillow 37579.4/67229: 56% mana arcane_charge, redirected_anima(9)
1:32.047 aoe o arcane_explosion Fluffy_Pillow 34335.5/67229: 51% mana arcane_charge(2), clearcasting, redirected_anima(9)
1:33.354 aoe o arcane_explosion Fluffy_Pillow 36092.8/67229: 54% mana arcane_charge(3), redirected_anima(9)
1:34.661 aoe p arcane_barrage Fluffy_Pillow 32640.8/66800: 49% mana arcane_charge(4), clearcasting, redirected_anima(8)
1:35.967 aoe o arcane_explosion Fluffy_Pillow 37295.3/67229: 55% mana clearcasting, redirected_anima(9)
1:37.276 aoe j touch_of_the_magi Fluffy_Pillow 39055.4/67229: 58% mana arcane_charge, redirected_anima(9)
1:38.581 aoe k arcane_power Fluffy_Pillow 38310.0/67229: 57% mana arcane_charge(4), redirected_anima(9)
1:38.581 aoe p arcane_barrage Fluffy_Pillow 38310.0/67229: 57% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(9)
1:39.888 aoe o arcane_explosion Fluffy_Pillow 42484.0/66800: 64% mana arcane_power, rune_of_power, redirected_anima(8)
1:41.194 aoe o arcane_explosion Fluffy_Pillow 41728.8/66800: 62% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(8)
1:42.500 aoe o arcane_explosion Fluffy_Pillow 40973.6/66800: 61% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, redirected_anima(8)
1:43.806 aoe o arcane_explosion Fluffy_Pillow 42718.4/66800: 64% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(8)
1:45.112 aoe p arcane_barrage Fluffy_Pillow 41963.2/66800: 63% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8)
1:46.420 aoe o arcane_explosion Fluffy_Pillow 46382.7/66800: 69% mana arcane_power, rune_of_power, redirected_anima(8)
1:47.727 aoe o arcane_explosion Fluffy_Pillow 45336.1/66371: 68% mana arcane_charge, arcane_power, clearcasting, rune_of_power, redirected_anima(7)
1:49.033 aoe o arcane_explosion Fluffy_Pillow 47373.7/66800: 71% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(8)
1:50.340 aoe o arcane_explosion Fluffy_Pillow 44825.2/64229: 70% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(2)
1:51.646 aoe p arcane_barrage Fluffy_Pillow 44002.9/64229: 69% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(2)
1:52.953 aoe m arcane_orb Fluffy_Pillow 48251.0/64229: 75% mana arcane_power, rune_of_power, redirected_anima(2)
1:54.261 aoe l rune_of_power Fluffy_Pillow 49681.2/64229: 77% mana arcane_charge(4), redirected_anima(2)
1:55.568 aoe p arcane_barrage Fluffy_Pillow 51360.1/64229: 80% mana arcane_charge(4), rune_of_power, redirected_anima(2)
1:56.875 aoe o arcane_explosion Fluffy_Pillow 55608.2/64229: 87% mana rune_of_power, redirected_anima(2)
1:58.181 aoe o arcane_explosion Fluffy_Pillow 52285.8/64229: 81% mana arcane_charge, rune_of_power, redirected_anima(2)
1:59.485 aoe o arcane_explosion Fluffy_Pillow 49287.6/64657: 76% mana arcane_charge(2), rune_of_power, redirected_anima(3)
2:00.792 aoe o arcane_explosion Fluffy_Pillow 45977.8/64657: 71% mana arcane_charge(3), rune_of_power, redirected_anima(3)
2:02.099 aoe p arcane_barrage Fluffy_Pillow 42667.9/64657: 66% mana arcane_charge(4), rune_of_power, redirected_anima(3)
2:03.406 aoe o arcane_explosion Fluffy_Pillow 46944.3/64657: 73% mana rune_of_power, redirected_anima(3)
2:04.713 aoe o arcane_explosion Fluffy_Pillow 43345.2/64229: 67% mana arcane_charge, rune_of_power, redirected_anima(2)
2:06.018 aoe o arcane_explosion Fluffy_Pillow 40021.6/64229: 62% mana arcane_charge(2), rune_of_power, redirected_anima(2)
2:07.324 aoe o arcane_explosion Fluffy_Pillow 36699.2/64229: 57% mana arcane_charge(3), clearcasting, rune_of_power, redirected_anima(2)
2:08.630 aoe p arcane_barrage Fluffy_Pillow 38376.9/64229: 60% mana arcane_charge(4), rune_of_power, redirected_anima(2)
2:09.936 aoe o arcane_explosion Fluffy_Pillow 42623.7/64229: 66% mana rune_of_power, redirected_anima(2)
2:11.242 aoe n shifting_power Fluffy_Pillow 39301.3/64229: 61% mana arcane_charge, clearcasting, redirected_anima(2)
2:14.940 aoe o arcane_explosion Fluffy_Pillow 43215.2/66800: 65% mana arcane_charge, clearcasting, redirected_anima(8)
2:16.246 aoe o arcane_explosion Fluffy_Pillow 44960.0/66800: 67% mana arcane_charge(2), redirected_anima(8)
2:17.552 aoe o arcane_explosion Fluffy_Pillow 41704.9/66800: 62% mana arcane_charge(3), redirected_anima(8)
2:18.858 aoe p arcane_barrage Fluffy_Pillow 38203.0/66371: 58% mana arcane_charge(4), redirected_anima(7)
2:20.163 aoe m arcane_orb Fluffy_Pillow 42590.1/66371: 64% mana redirected_anima(7)
2:21.470 shared_cds r use_mana_gem NightFae_Niya 43825.1/66371: 66% mana arcane_charge(4), redirected_anima(7)
2:21.470 aoe p arcane_barrage Fluffy_Pillow 50462.2/66371: 76% mana arcane_charge(4), redirected_anima(7)
2:22.776 aoe o arcane_explosion Fluffy_Pillow 54850.7/66371: 83% mana redirected_anima(7)
2:24.084 aoe o arcane_explosion Fluffy_Pillow 51587.0/66371: 78% mana arcane_charge, redirected_anima(7)
2:25.390 aoe o arcane_explosion Fluffy_Pillow 48320.6/66371: 73% mana arcane_charge(2), clearcasting, redirected_anima(7)
2:26.697 aoe o arcane_explosion Fluffy_Pillow 50055.6/66371: 75% mana arcane_charge(3), redirected_anima(7)
2:28.004 aoe p arcane_barrage Fluffy_Pillow 46790.5/66371: 70% mana arcane_charge(4), redirected_anima(7)
2:29.310 aoe j touch_of_the_magi Fluffy_Pillow 50848.5/65943: 77% mana redirected_anima(6)
2:30.616 aoe l rune_of_power Fluffy_Pillow 50070.9/65943: 76% mana arcane_charge(4), redirected_anima(6)
2:31.922 aoe p arcane_barrage Fluffy_Pillow 51793.4/65943: 79% mana arcane_charge(4), rune_of_power, redirected_anima(6)
2:33.228 aoe o arcane_explosion Fluffy_Pillow 56153.5/65943: 85% mana rune_of_power, redirected_anima(6)
2:34.534 aoe o arcane_explosion Fluffy_Pillow 52875.9/65943: 80% mana arcane_charge, rune_of_power, redirected_anima(6)
2:35.840 aoe o arcane_explosion Fluffy_Pillow 49598.4/65943: 75% mana arcane_charge(2), rune_of_power, redirected_anima(6)
2:37.146 aoe o arcane_explosion Fluffy_Pillow 46320.8/65943: 70% mana arcane_charge(3), clearcasting, rune_of_power, redirected_anima(6)
2:38.453 aoe p arcane_barrage Fluffy_Pillow 48044.5/65943: 73% mana arcane_charge(4), rune_of_power, redirected_anima(6)
2:39.760 aoe o arcane_explosion Fluffy_Pillow 52406.0/65943: 79% mana rune_of_power, redirected_anima(6)
2:41.068 aoe o arcane_explosion Fluffy_Pillow 49131.1/65943: 75% mana arcane_charge, rune_of_power, redirected_anima(6)
2:42.376 aoe o arcane_explosion Fluffy_Pillow 44068.0/63371: 70% mana arcane_charge(2), rune_of_power
2:43.683 aoe o arcane_explosion Fluffy_Pillow 40724.5/63371: 64% mana arcane_charge(3), rune_of_power
2:44.989 aoe p arcane_barrage Fluffy_Pillow 37379.8/63371: 59% mana arcane_charge(4), rune_of_power
2:46.295 aoe m arcane_orb Fluffy_Pillow 41569.9/63371: 66% mana rune_of_power
2:47.601 aoe p arcane_barrage Fluffy_Pillow 43014.1/63800: 67% mana arcane_charge(4), redirected_anima
2:48.907 aoe o arcane_explosion Fluffy_Pillow 47232.6/63800: 74% mana redirected_anima
2:50.216 aoe o arcane_explosion Fluffy_Pillow 43902.8/63800: 69% mana arcane_charge, clearcasting, redirected_anima
2:51.521 aoe o arcane_explosion Fluffy_Pillow 45568.0/63800: 71% mana arcane_charge(2), redirected_anima
2:52.829 aoe o arcane_explosion Fluffy_Pillow 42237.0/63800: 66% mana arcane_charge(3), redirected_anima
2:54.135 aoe p arcane_barrage Fluffy_Pillow 38903.5/63800: 61% mana arcane_charge(4), redirected_anima
2:55.441 aoe o arcane_explosion Fluffy_Pillow 43121.9/63800: 68% mana redirected_anima
2:56.749 aoe n shifting_power Fluffy_Pillow 39790.9/63800: 62% mana arcane_charge, redirected_anima
3:00.411 aoe o arcane_explosion Fluffy_Pillow 43655.0/66371: 66% mana arcane_charge, redirected_anima(7)
3:01.716 aoe o arcane_explosion Fluffy_Pillow 40387.3/66371: 61% mana arcane_charge(2), redirected_anima(7)
3:03.021 aoe o arcane_explosion Fluffy_Pillow 37119.6/66371: 56% mana arcane_charge(3), clearcasting, redirected_anima(7)
3:04.328 aoe p arcane_barrage Fluffy_Pillow 38854.5/66371: 59% mana arcane_charge(4), redirected_anima(7)
3:05.633 aoe m arcane_orb Fluffy_Pillow 43241.7/66371: 65% mana redirected_anima(7)
3:06.938 aoe p arcane_barrage Fluffy_Pillow 44761.1/66800: 67% mana arcane_charge(4), redirected_anima(8)
3:08.244 aoe o arcane_explosion Fluffy_Pillow 49178.0/66800: 74% mana redirected_anima(8)
3:09.551 aoe o arcane_explosion Fluffy_Pillow 45924.1/66800: 69% mana arcane_charge, redirected_anima(8)
3:10.857 aoe o arcane_explosion Fluffy_Pillow 42668.9/66800: 64% mana arcane_charge(2), redirected_anima(8)
3:12.163 aoe o arcane_explosion Fluffy_Pillow 39413.7/66800: 59% mana arcane_charge(3), clearcasting, redirected_anima(8)
3:13.470 aoe p arcane_barrage Fluffy_Pillow 41159.9/66800: 62% mana arcane_charge(4), redirected_anima(8)
3:14.777 aoe j touch_of_the_magi Fluffy_Pillow 45578.0/66800: 68% mana redirected_anima(8)
3:16.083 aoe k arcane_power Fluffy_Pillow 44822.9/66800: 67% mana arcane_charge(4), redirected_anima(8)
3:16.083 shared_cds t berserking Fluffy_Pillow 44822.9/66800: 67% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8)
3:16.083 aoe p arcane_barrage Fluffy_Pillow 44822.9/66800: 67% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8)
3:17.273 aoe o arcane_explosion Fluffy_Pillow 48769.8/66371: 73% mana berserking, arcane_power, rune_of_power, redirected_anima(7)
3:18.462 aoe o arcane_explosion Fluffy_Pillow 47848.1/66371: 72% mana berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(7)
3:19.653 aoe o arcane_explosion Fluffy_Pillow 46929.1/66371: 71% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(7)
3:20.842 aoe o arcane_explosion Fluffy_Pillow 46007.4/66371: 69% mana berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima(7)
3:22.029 aoe p arcane_barrage Fluffy_Pillow 45083.0/66371: 68% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima(7)
3:23.217 aoe o arcane_explosion Fluffy_Pillow 49314.9/66371: 74% mana berserking, arcane_power, clearcasting, rune_of_power, redirected_anima(7)
3:24.404 aoe o arcane_explosion Fluffy_Pillow 50890.5/66371: 77% mana berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(7)
3:25.593 aoe o arcane_explosion Fluffy_Pillow 49968.9/66371: 75% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(7)
3:26.781 aoe o arcane_explosion Fluffy_Pillow 47145.7/63800: 74% mana berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima
3:27.970 aoe p arcane_barrage Fluffy_Pillow 46162.8/63800: 72% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima
3:29.158 aoe m arcane_orb Fluffy_Pillow 50230.7/63800: 79% mana arcane_power, clearcasting, rune_of_power, redirected_anima
3:30.465 aoe p arcane_barrage Fluffy_Pillow 51648.4/63800: 81% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima
3:31.870 aoe o arcane_explosion Fluffy_Pillow 56369.3/64229: 88% mana clearcasting, redirected_anima(2)
3:33.179 aoe o arcane_explosion Fluffy_Pillow 58438.2/64657: 90% mana arcane_charge, redirected_anima(3)
3:34.486 aoe o arcane_explosion Fluffy_Pillow 55128.3/64657: 85% mana arcane_charge(2), redirected_anima(3)
3:35.793 aoe o arcane_explosion Fluffy_Pillow 51475.0/64229: 80% mana arcane_charge(3), redirected_anima(2)
3:37.101 aoe l rune_of_power Fluffy_Pillow 48155.2/64229: 75% mana arcane_charge(4), clearcasting, redirected_anima(2)
3:38.408 aoe p arcane_barrage Fluffy_Pillow 49834.2/64229: 78% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(2)
3:39.714 aoe o arcane_explosion Fluffy_Pillow 54081.0/64229: 84% mana clearcasting, rune_of_power, redirected_anima(2)
3:41.019 aoe o arcane_explosion Fluffy_Pillow 55757.3/64229: 87% mana arcane_charge, rune_of_power, redirected_anima(2)
3:42.326 aoe o arcane_explosion Fluffy_Pillow 52436.3/64229: 82% mana arcane_charge(2), rune_of_power, redirected_anima(2)
3:43.632 aoe o arcane_explosion Fluffy_Pillow 49113.9/64229: 76% mana arcane_charge(3), rune_of_power, redirected_anima(2)
3:44.938 aoe p arcane_barrage Fluffy_Pillow 45791.6/64229: 71% mana arcane_charge(4), rune_of_power, redirected_anima(2)
3:46.245 aoe o arcane_explosion Fluffy_Pillow 50039.6/64229: 78% mana rune_of_power, redirected_anima(2)
3:47.550 aoe o arcane_explosion Fluffy_Pillow 46716.0/64229: 73% mana arcane_charge, rune_of_power, redirected_anima(2)
3:48.857 aoe o arcane_explosion Fluffy_Pillow 43394.9/64229: 68% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(2)
3:50.164 aoe o arcane_explosion Fluffy_Pillow 45073.9/64229: 70% mana arcane_charge(3), rune_of_power, redirected_anima(2)
3:51.471 aoe p arcane_barrage Fluffy_Pillow 41752.8/64229: 65% mana arcane_charge(4), rune_of_power, redirected_anima(2)
3:52.778 aoe m arcane_orb Fluffy_Pillow 46000.9/64229: 72% mana rune_of_power, redirected_anima(2)
3:54.084 aoe n shifting_power Fluffy_Pillow 47178.5/64229: 73% mana arcane_charge(4), redirected_anima(2)
3:57.793 aoe p arcane_barrage Fluffy_Pillow 51422.5/66800: 77% mana arcane_charge(4), redirected_anima(8)
3:59.098 aoe o arcane_explosion Fluffy_Pillow 55838.0/66800: 84% mana redirected_anima(8)
4:00.405 aoe o arcane_explosion Fluffy_Pillow 52584.1/66800: 79% mana arcane_charge, redirected_anima(8)
4:01.712 aoe o arcane_explosion Fluffy_Pillow 49013.8/66371: 74% mana arcane_charge(2), redirected_anima(7)
4:03.019 aoe o arcane_explosion Fluffy_Pillow 45453.3/65943: 69% mana arcane_charge(3), redirected_anima(6)
4:04.326 aoe p arcane_barrage Fluffy_Pillow 42177.1/65943: 64% mana arcane_charge(4), redirected_anima(6)
4:05.632 aoe m arcane_orb Fluffy_Pillow 46537.2/65943: 71% mana redirected_anima(6)
4:06.938 aoe p arcane_barrage Fluffy_Pillow 47759.6/65943: 72% mana arcane_charge(4), redirected_anima(6)
4:08.244 aoe o arcane_explosion Fluffy_Pillow 52119.8/65943: 79% mana redirected_anima(6)
4:09.551 aoe o arcane_explosion Fluffy_Pillow 48843.5/65943: 74% mana arcane_charge, clearcasting, redirected_anima(6)
4:10.858 aoe j touch_of_the_magi Fluffy_Pillow 50567.3/65943: 77% mana arcane_charge(2), redirected_anima(6)
4:12.166 aoe l rune_of_power Fluffy_Pillow 49792.3/65943: 76% mana arcane_charge(4), redirected_anima(6)
4:13.471 aoe p arcane_barrage Fluffy_Pillow 51513.4/65943: 78% mana arcane_charge(4), rune_of_power, redirected_anima(6)
4:14.778 aoe o arcane_explosion Fluffy_Pillow 55874.9/65943: 85% mana rune_of_power, redirected_anima(6)
4:16.084 aoe o arcane_explosion Fluffy_Pillow 52597.3/65943: 80% mana arcane_charge, clearcasting, rune_of_power, redirected_anima(6)
4:17.391 aoe o arcane_explosion Fluffy_Pillow 54321.1/65943: 82% mana arcane_charge(2), rune_of_power, redirected_anima(6)
4:18.698 aoe o arcane_explosion Fluffy_Pillow 51044.8/65943: 77% mana arcane_charge(3), rune_of_power, redirected_anima(6)
4:20.005 aoe p arcane_barrage Fluffy_Pillow 47768.6/65943: 72% mana arcane_charge(4), rune_of_power, redirected_anima(6)
4:21.311 shared_cds r use_mana_gem NightFae_Niya 52128.7/65943: 79% mana rune_of_power, redirected_anima(6)
4:21.470 aoe o arcane_explosion Fluffy_Pillow 58932.7/65943: 89% mana rune_of_power, redirected_anima(6)
4:22.778 aoe o arcane_explosion Fluffy_Pillow 55657.8/65943: 84% mana arcane_charge, rune_of_power, redirected_anima(6)
4:24.086 aoe o arcane_explosion Fluffy_Pillow 52382.8/65943: 79% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(6)
4:25.394 aoe o arcane_explosion Fluffy_Pillow 51998.0/63371: 82% mana arcane_charge(3), rune_of_power
4:26.702 aoe p arcane_barrage Fluffy_Pillow 48655.8/63371: 77% mana arcane_charge(4), rune_of_power
4:28.009 aoe m arcane_orb Fluffy_Pillow 52847.1/63371: 83% mana rune_of_power
4:29.314 aoe p arcane_barrage Fluffy_Pillow 54001.1/63371: 85% mana arcane_charge(4)
4:30.620 aoe o arcane_explosion Fluffy_Pillow 58191.3/63371: 92% mana

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Niya"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=322721//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Nadjia : 17022 dps, 4790 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17022.4 17022.4 25.1 / 0.148% 1559.4 / 9.2% 8.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
2093.5 1993.2 Mana 0.00% 50.4 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 17022
Arcane Barrage 5881 34.6% 57.4 5.20sec 30655 25088 Direct 286.6 5135 10327 6139 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.39 286.61 0.00 0.00 1.2219 0.0000 1759249.78 1759249.78 0.00% 25087.70 25087.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 231.15 175 291 5135.19 2082 25140 5128.21 4465 5567 1186714 1186714 0.00%
crit 19.35% 55.46 35 87 10326.83 4164 50280 10308.82 8012 13794 572536 572536 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.39
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 461 2.7% 43.2 6.47sec 3186 0 Direct 216.0 534 1069 637 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.20 216.02 0.00 0.00 0.0000 0.0000 137631.99 137631.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 174.44 125 217 534.32 316 664 533.57 498 558 93182 93182 0.00%
crit 19.25% 41.58 19 65 1069.30 633 1329 1067.80 947 1171 44450 44450 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7980 46.9% 156.1 1.89sec 15272 12548 Direct 780.4 2563 5124 3055 19.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 156.09 780.43 0.00 0.00 1.2171 0.0000 2383758.94 2383758.94 0.00% 12548.48 12548.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 630.48 489 783 2562.83 1958 4112 2563.24 2493 2654 1615575 1615575 0.00%
crit 19.21% 149.95 99 204 5123.99 3916 8223 5124.55 4729 5623 768184 768184 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:156.11
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1422) 0.0% (8.4%) 13.1 23.40sec 32350 26286

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.14 0.00 0.00 0.00 1.2307 0.0000 0.00 0.00 0.00% 26286.21 26286.21

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.13
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1422 8.4% 65.6 23.40sec 6479 0 Direct 65.6 5432 10877 6482 19.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.59 65.59 0.00 0.00 0.0000 0.0000 424969.14 424969.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 52.97 38 71 5432.12 3869 8126 5430.40 4756 5841 287641 287641 0.00%
crit 19.25% 12.63 3 23 10877.27 7739 16251 10874.68 8453 15035 137328 137328 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.78sec 1382 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.78sec 1382 0 Direct 14.7 1164 2327 1382 18.7%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.67 14.67 0.00 0.00 0.0000 0.0000 20263.50 20263.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.25% 11.92 6 19 1163.53 1164 1164 1163.53 1164 1164 13865 13865 0.00%
crit 18.75% 2.75 0 8 2327.06 2327 2327 2205.91 0 2327 6398 6398 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1766 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1765.76 1765.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 0.81 0 1 1480.68 1481 1481 1195.60 0 1481 1196 1196 0.00%
crit 19.25% 0.19 0 1 2961.35 2961 2961 570.16 0 2961 570 570 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.1%) 1.0 0.00sec 6094 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 21 0.1% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6093.75 6093.75 0.00% 51.74 51.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 72.71 61 83 56.80 43 60 56.80 56 58 4130 4130 0.00%
crit 19.21% 17.29 7 29 113.60 86 120 113.58 99 120 1964 1964 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (158) 0.0% (0.9%) 2.9 129.17sec 16492 13401

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.2309 0.0000 0.00 0.00 0.00% 13400.80 13400.80

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.88
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 70 0.4% 5.6 52.93sec 3700 0 Direct 5.6 3101 6150 3699 19.6%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.64 5.64 0.00 0.00 0.0000 0.0000 20879.33 20879.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.37% 4.54 0 6 3100.98 1739 3651 3082.43 0 3651 14058 14058 0.00%
crit 19.63% 1.11 0 4 6150.42 3477 7302 4340.66 0 7302 6822 6822 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 88 0.5% 2.7 131.87sec 9664 0 Direct 2.7 8046 16350 9663 19.5%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 2.74 0.00 0.00 0.0000 0.0000 26505.90 26505.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 2.21 0 3 8045.96 6126 9188 7862.01 0 9188 17757 17757 0.00%
crit 19.52% 0.54 0 3 16349.54 12251 18377 7334.00 0 18377 8749 8749 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (1024) 0.0% (6.0%) 6.1 51.93sec 49780 40797

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 0.00 0.00 0.00 1.2202 0.0000 0.00 0.00 0.00% 40796.52 40796.52

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.17
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1024 6.0% 6.1 51.81sec 49780 0 Direct 30.6 9982 0 9982 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 30.65 0.00 0.00 0.0000 0.0000 305769.91 305769.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.65 25 35 9981.53 1212 54764 9970.45 7564 13426 305770 305770 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:23719.03
  • base_dd_max:23719.03
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Nadjia
Arcane Power 2.9 127.23sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.86
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 254.36sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.86
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 181.49sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.16 0.00 6.90 0.00 4.1848 0.7018 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:1.16
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.9 50.52sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 0.00 0.00 0.00 1.2194 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.96
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.41sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.1 182.8 5.1sec 1.2sec 3.8sec 73.46% 0.00% 27.2 (28.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s

Stack Uptimes

  • arcane_charge_1:18.75%
  • arcane_charge_2:16.99%
  • arcane_charge_3:16.51%
  • arcane_charge_4:21.21%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.3sec 127.3sec 14.6sec 13.98% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.3s / 131.7s
  • trigger_min/max:121.3s / 131.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.98%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 254.5sec 254.5sec 11.6sec 7.17% 12.76% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:252.5s / 263.0s
  • trigger_min/max:252.5s / 263.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.17%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.8 0.2 11.7sec 11.6sec 1.9sec 15.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.79%
  • clearcasting_2:0.15%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.15% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 10.0s

Stack Uptimes

  • euphoria_1:11.15%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 1.2 0.0 176.3sec 176.3sec 4.2sec 1.63% 0.00% 4.6 (4.6) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.7s / 265.6s
  • trigger_min/max:90.7s / 265.6s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 4.3s

Stack Uptimes

  • evocation_1:1.63%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.48%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.3sec 35.3sec 14.7sec 43.18% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 51.8s
  • trigger_min/max:15.7s / 51.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:43.18%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 144.6 78.0sec 2.0sec 66.7sec 97.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.92%
  • thrill_seeker_3:2.91%
  • thrill_seeker_4:2.90%
  • thrill_seeker_5:2.87%
  • thrill_seeker_6:2.85%
  • thrill_seeker_7:2.83%
  • thrill_seeker_8:2.80%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.76%
  • thrill_seeker_11:2.74%
  • thrill_seeker_12:2.72%
  • thrill_seeker_13:2.69%
  • thrill_seeker_14:2.66%
  • thrill_seeker_15:2.64%
  • thrill_seeker_16:2.62%
  • thrill_seeker_17:2.59%
  • thrill_seeker_18:2.57%
  • thrill_seeker_19:2.55%
  • thrill_seeker_20:2.53%
  • thrill_seeker_21:2.51%
  • thrill_seeker_22:2.49%
  • thrill_seeker_23:2.47%
  • thrill_seeker_24:2.44%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.42%
  • thrill_seeker_27:2.41%
  • thrill_seeker_28:2.40%
  • thrill_seeker_29:2.38%
  • thrill_seeker_30:2.37%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.34%
  • thrill_seeker_33:2.33%
  • thrill_seeker_34:2.32%
  • thrill_seeker_35:2.31%
  • thrill_seeker_36:2.30%
  • thrill_seeker_37:2.29%
  • thrill_seeker_38:2.28%
  • thrill_seeker_39:2.26%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.43% 0.79% 7.87% 0.8s 0.0s 4.8s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.911120.053239.917
Evocation138.5450.709345.734210.585138.451356.863
Rune of Power6.6170.06626.87241.59022.72355.352
Touch of the Magi4.9190.00025.34032.35321.41654.045
Arcane Power5.5541.30211.65216.0769.46125.339
Arcane Barrage2.7590.0008.933159.382125.795193.836
Arcane Orb3.4030.01310.48644.92932.23559.450
Mirrors of Torment24.8460.00071.47672.44166.901139.504

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
mana_regen Mana 528.71 366723.14 61.56% 693.62 11507.53 3.04%
Evocation Mana 53.84 55652.16 9.34% 1033.59 0.00 0.00%
Mana Gem Mana 2.73 17283.12 2.90% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.39 138604.79 23.27% 2415.31 6860.22 4.72%
Mirrors of Torment Mana 8.40 17444.80 2.93% 2077.86 3836.72 18.03%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1993.21 2093.46 22206.1 33405.5 233.2 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
arcane_explosion Mana 156.1 597751.5 3829.0 3829.6 4.0
arcane_orb Mana 13.1 5869.9 446.9 446.8 72.4
mirrors_of_torment Mana 2.9 5750.5 2000.0 2001.4 8.2
touch_of_the_magi Mana 6.1 15349.4 2499.8 2498.9 19.9

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Venthyr_Nadjia Damage Per Second
Count 1018
Mean 17022.37
Minimum 15843.54
Maximum 18368.21
Spread ( max - min ) 2524.67
Range [ ( max - min ) / 2 * 100% ] 7.42%
Standard Deviation 409.0632
5th Percentile 16379.55
95th Percentile 17718.10
( 95th Percentile - 5th Percentile ) 1338.55
Mean Distribution
Standard Deviation 12.8208
95.00% Confidence Interval ( 16997.24 - 17047.50 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2219
0.1 Scale Factor Error with Delta=300 1429
0.05 Scale Factor Error with Delta=300 5714
0.01 Scale Factor Error with Delta=300 142845
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 1018
Mean 4790.10
Minimum 4277.75
Maximum 5407.07
Spread ( max - min ) 1129.32
Range [ ( max - min ) / 2 * 100% ] 11.79%
Standard Deviation 181.3037
5th Percentile 4499.69
95th Percentile 5104.46
( 95th Percentile - 5th Percentile ) 604.77
Mean Distribution
Standard Deviation 5.6824
95.00% Confidence Interval ( 4778.96 - 4801.24 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5504
0.1 Scale Factor Error with Delta=300 281
0.05 Scale Factor Error with Delta=300 1123
0.01 Scale Factor Error with Delta=300 28061
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 1018
Mean 17022.37
Minimum 15843.54
Maximum 18368.21
Spread ( max - min ) 2524.67
Range [ ( max - min ) / 2 * 100% ] 7.42%
Damage
Venthyr_Nadjia Damage
Count 1018
Mean 5080794.25
Minimum 3954454.06
Maximum 6193982.83
Spread ( max - min ) 2239528.76
Range [ ( max - min ) / 2 * 100% ] 22.04%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.88 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.17 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.86 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.96 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.13 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 156.11 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.39 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 1.16 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.86 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooorpnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooqopnpoooopookmpoooopnpoooolpoooopoooopnpoooorpoooopjkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopjkltpoooopnpoooo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 61376.5/63371: 97% mana bloodlust
0:02.314 aoe l arcane_power Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), clearcasting, thrill_seeker
0:02.314 shared_cds s potion Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker
0:02.314 shared_cds t berserking Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:02.314 aoe p arcane_barrage Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:03.228 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:04.142 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.057 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.972 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:06.887 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:07.801 aoe o arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:08.716 aoe p arcane_barrage Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:09.632 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:10.546 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:11.460 aoe o arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:12.373 aoe o arcane_explosion Fluffy_Pillow 59345.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:13.288 aoe p arcane_barrage Fluffy_Pillow 58005.1/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:14.202 aoe o arcane_explosion Fluffy_Pillow 61698.4/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(8), potion_of_deathly_fixation
0:15.115 aoe o arcane_explosion Fluffy_Pillow 62890.5/63371: 99% mana bloodlust, arcane_charge, arcane_power, rune_of_power, thrill_seeker(8), potion_of_deathly_fixation
0:16.121 aoe o arcane_explosion Fluffy_Pillow 61665.5/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(9), potion_of_deathly_fixation
0:17.127 aoe o arcane_explosion Fluffy_Pillow 60440.5/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(9), potion_of_deathly_fixation
0:18.134 aoe m rune_of_power Fluffy_Pillow 59216.8/63371: 93% mana bloodlust, arcane_charge(4), thrill_seeker(10), potion_of_deathly_fixation
0:19.141 aoe p arcane_barrage Fluffy_Pillow 60493.1/63371: 95% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(10), potion_of_deathly_fixation
0:20.147 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:21.154 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:22.159 aoe o arcane_explosion Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:23.166 aoe o arcane_explosion Fluffy_Pillow 57197.8/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:24.172 shared_cds r use_mana_gem Venthyr_Nadjia 53472.8/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:24.172 aoe p arcane_barrage Fluffy_Pillow 59810.0/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:25.179 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:26.186 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:27.193 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:28.197 aoe o arcane_explosion Fluffy_Pillow 59643.9/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, thrill_seeker(15)
0:29.205 aoe o arcane_explosion Fluffy_Pillow 60921.5/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(15)
0:30.212 aoe o arcane_explosion Fluffy_Pillow 57197.8/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(16)
0:31.218 aoe p arcane_barrage Fluffy_Pillow 53472.8/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(16)
0:32.224 aoe o arcane_explosion Fluffy_Pillow 57282.7/63371: 90% mana bloodlust, rune_of_power, thrill_seeker(17)
0:33.230 aoe o arcane_explosion Fluffy_Pillow 53557.8/63371: 85% mana bloodlust, arcane_charge, clearcasting, rune_of_power, thrill_seeker(17)
0:34.237 aoe o arcane_explosion Fluffy_Pillow 54834.1/63371: 87% mana bloodlust, arcane_charge(2), thrill_seeker(18)
0:35.244 aoe o arcane_explosion Fluffy_Pillow 51110.4/63371: 81% mana bloodlust, arcane_charge(3), thrill_seeker(18)
0:36.253 aoe p arcane_barrage Fluffy_Pillow 47389.2/63371: 75% mana bloodlust, arcane_charge(4), thrill_seeker(19)
0:37.261 aoe o arcane_explosion Fluffy_Pillow 51201.6/63371: 81% mana bloodlust, thrill_seeker(19)
0:38.266 aoe o arcane_explosion Fluffy_Pillow 47475.4/63371: 75% mana bloodlust, arcane_charge, thrill_seeker(20)
0:39.272 aoe o arcane_explosion Fluffy_Pillow 43750.4/63371: 69% mana bloodlust, arcane_charge(2), thrill_seeker(20)
0:40.279 aoe o arcane_explosion Fluffy_Pillow 40026.7/63371: 63% mana bloodlust, arcane_charge(3), thrill_seeker(21)
0:41.286 aoe p arcane_barrage Fluffy_Pillow 36303.0/63371: 57% mana arcane_charge(4), thrill_seeker(21)
0:42.591 aoe o arcane_explosion Fluffy_Pillow 40491.9/63371: 64% mana thrill_seeker(22)
0:43.897 aoe o arcane_explosion Fluffy_Pillow 37147.1/63371: 59% mana arcane_charge, thrill_seeker(22)
0:45.202 aoe o arcane_explosion Fluffy_Pillow 33801.1/63371: 53% mana arcane_charge(2), thrill_seeker(23)
0:46.508 aoe o arcane_explosion Fluffy_Pillow 30456.4/63371: 48% mana arcane_charge(3), thrill_seeker(24)
0:47.814 aoe p arcane_barrage Fluffy_Pillow 27111.6/63371: 43% mana arcane_charge(4), thrill_seeker(24)
0:49.123 aoe n arcane_orb Fluffy_Pillow 31305.6/63371: 49% mana thrill_seeker(25)
0:50.430 aoe p arcane_barrage Fluffy_Pillow 32462.1/63371: 51% mana arcane_charge(4), thrill_seeker(26)
0:51.738 aoe o arcane_explosion Fluffy_Pillow 36654.7/63371: 58% mana thrill_seeker(26)
0:53.043 aoe o arcane_explosion Fluffy_Pillow 33308.7/63371: 53% mana arcane_charge, thrill_seeker(27)
0:54.349 aoe o arcane_explosion Fluffy_Pillow 29964.0/63371: 47% mana arcane_charge(2), thrill_seeker(28)
0:55.655 aoe o arcane_explosion Fluffy_Pillow 26619.3/63371: 42% mana arcane_charge(3), thrill_seeker(28)
0:56.961 aoe p arcane_barrage Fluffy_Pillow 23274.5/63371: 37% mana arcane_charge(4), thrill_seeker(29)
0:58.266 aoe o arcane_explosion Fluffy_Pillow 27463.4/63371: 43% mana thrill_seeker(30)
0:59.572 aoe o arcane_explosion Fluffy_Pillow 24118.6/63371: 38% mana arcane_charge, thrill_seeker(30)
1:00.879 aoe o arcane_explosion Fluffy_Pillow 20775.2/63371: 33% mana arcane_charge(2), thrill_seeker(31)
1:02.185 aoe o arcane_explosion Fluffy_Pillow 17430.4/63371: 28% mana arcane_charge(3), thrill_seeker(32)
1:03.493 aoe p arcane_barrage Fluffy_Pillow 14088.2/63371: 22% mana arcane_charge(4), thrill_seeker(32)
1:04.800 aoe k touch_of_the_magi Fluffy_Pillow 18279.6/63371: 29% mana thrill_seeker(33)
1:06.108 aoe m rune_of_power Fluffy_Pillow 17437.4/63371: 28% mana arcane_charge(4), thrill_seeker(34)
1:07.415 aoe p arcane_barrage Fluffy_Pillow 19093.9/63371: 30% mana arcane_charge(4), rune_of_power, thrill_seeker(34)
1:08.721 aoe o arcane_explosion Fluffy_Pillow 23284.1/63371: 37% mana rune_of_power, thrill_seeker(35)
1:10.029 aoe o arcane_explosion Fluffy_Pillow 19941.9/63371: 31% mana arcane_charge, rune_of_power, thrill_seeker(36)
1:11.336 aoe o arcane_explosion Fluffy_Pillow 16598.4/63371: 26% mana arcane_charge(2), clearcasting, rune_of_power, thrill_seeker(36)
1:12.643 aoe o arcane_explosion Fluffy_Pillow 18254.9/63371: 29% mana arcane_charge(3), rune_of_power, thrill_seeker(37)
1:13.949 aoe p arcane_barrage Fluffy_Pillow 14910.2/63371: 24% mana arcane_charge(4), rune_of_power, thrill_seeker(37)
1:15.254 aoe n arcane_orb Fluffy_Pillow 19099.0/63371: 30% mana rune_of_power, thrill_seeker(38)
1:16.562 aoe p arcane_barrage Fluffy_Pillow 20256.8/63371: 32% mana arcane_charge(4), rune_of_power, thrill_seeker(39)
1:17.868 aoe o arcane_explosion Fluffy_Pillow 24446.9/63371: 39% mana rune_of_power, thrill_seeker(39)
1:19.174 aoe o arcane_explosion Fluffy_Pillow 21102.2/63371: 33% mana arcane_charge, clearcasting, rune_of_power, euphoria
1:20.265 aoe o arcane_explosion Fluffy_Pillow 22485.0/63371: 35% mana arcane_charge(2), rune_of_power, thrill_seeker, euphoria
1:21.353 aoe o arcane_explosion Fluffy_Pillow 18863.9/63371: 30% mana arcane_charge(3), rune_of_power, thrill_seeker, euphoria
1:22.444 aoe p arcane_barrage Fluffy_Pillow 15246.7/63371: 24% mana arcane_charge(4), thrill_seeker(3), euphoria
1:23.532 aoe o arcane_explosion Fluffy_Pillow 19160.5/63371: 30% mana thrill_seeker(3), euphoria
1:24.619 aoe o arcane_explosion Fluffy_Pillow 15538.2/63371: 25% mana arcane_charge, clearcasting, thrill_seeker(4), euphoria
1:25.708 aoe o arcane_explosion Fluffy_Pillow 16918.4/63371: 27% mana arcane_charge(2), thrill_seeker(4), euphoria
1:26.797 aoe o arcane_explosion Fluffy_Pillow 13298.7/63371: 21% mana arcane_charge(3), thrill_seeker(5), euphoria
1:27.887 aoe p arcane_barrage Fluffy_Pillow 9680.2/63371: 15% mana arcane_charge(4), thrill_seeker(5), euphoria
1:28.977 aoe o arcane_explosion Fluffy_Pillow 13596.5/63371: 21% mana thrill_seeker(6)
1:30.284 aoe o arcane_explosion Fluffy_Pillow 10253.1/63371: 16% mana arcane_charge, thrill_seeker(7)
1:31.590 aoe o arcane_explosion Fluffy_Pillow 6908.3/63371: 11% mana arcane_charge(2), thrill_seeker(7)
1:32.896 aoe q evocation Venthyr_Nadjia 3563.6/63371: 6% mana arcane_charge(3), thrill_seeker(8)
1:37.241 aoe o arcane_explosion Fluffy_Pillow 57409.5/63371: 91% mana arcane_charge(3), thrill_seeker(10)
1:38.547 aoe p arcane_barrage Fluffy_Pillow 54064.8/63371: 85% mana arcane_charge(4), clearcasting, thrill_seeker(11)
1:39.853 aoe n arcane_orb Fluffy_Pillow 58254.9/63371: 92% mana clearcasting, thrill_seeker(11)
1:41.160 aoe p arcane_barrage Fluffy_Pillow 59411.4/63371: 94% mana arcane_charge(4), clearcasting, thrill_seeker(12)
1:42.464 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, thrill_seeker(13)
1:43.770 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, thrill_seeker(13)
1:45.078 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge(2), clearcasting, thrill_seeker(14)
1:46.385 aoe o arcane_explosion Fluffy_Pillow 61685.8/63371: 97% mana arcane_charge(3), thrill_seeker(15)
1:47.691 aoe p arcane_barrage Fluffy_Pillow 58341.0/63371: 92% mana arcane_charge(4), clearcasting, thrill_seeker(15)
1:48.999 aoe o arcane_explosion Fluffy_Pillow 62533.7/63371: 99% mana clearcasting, thrill_seeker(16)
1:50.304 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, thrill_seeker(17)
1:51.613 aoe k touch_of_the_magi Fluffy_Pillow 60030.5/63371: 95% mana arcane_charge(2), clearcasting, thrill_seeker(17)
1:52.918 aoe m rune_of_power Fluffy_Pillow 59184.5/63371: 93% mana arcane_charge(4), clearcasting, thrill_seeker(18)
1:54.224 aoe p arcane_barrage Fluffy_Pillow 60839.7/63371: 96% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(19)
1:55.531 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power, thrill_seeker(19)
1:56.837 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power, thrill_seeker(20)
1:58.144 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge(2), clearcasting, rune_of_power, thrill_seeker(21)
1:59.451 aoe o arcane_explosion Fluffy_Pillow 61684.5/63371: 97% mana arcane_charge(3), rune_of_power, thrill_seeker(21)
2:00.756 aoe p arcane_barrage Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(4), rune_of_power, thrill_seeker(22)
2:02.062 aoe n arcane_orb Fluffy_Pillow 62528.6/63371: 99% mana rune_of_power, thrill_seeker(23)
2:03.368 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power, thrill_seeker(23)
2:04.672 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, thrill_seeker(24)
2:05.978 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power, thrill_seeker(24)
2:07.284 aoe o arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), rune_of_power, thrill_seeker(25)
2:08.592 aoe o arcane_explosion Fluffy_Pillow 53339.7/63371: 84% mana arcane_charge(3), rune_of_power, thrill_seeker(26)
2:09.898 aoe l arcane_power Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4), thrill_seeker(26)
2:09.898 aoe p arcane_barrage Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(26)
2:11.207 aoe o arcane_explosion Fluffy_Pillow 54188.9/63371: 86% mana arcane_power, rune_of_power, thrill_seeker(27)
2:12.515 aoe o arcane_explosion Fluffy_Pillow 53346.7/63371: 84% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(28)
2:13.822 aoe o arcane_explosion Fluffy_Pillow 52503.3/63371: 83% mana arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(28)
2:15.129 aoe o arcane_explosion Fluffy_Pillow 51659.8/63371: 82% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(29)
2:16.435 aoe p arcane_barrage Fluffy_Pillow 50815.0/63371: 80% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker(30)
2:17.742 aoe o arcane_explosion Fluffy_Pillow 55006.4/63371: 87% mana arcane_power, clearcasting, rune_of_power, thrill_seeker(30)
2:19.051 aoe o arcane_explosion Fluffy_Pillow 56665.5/63371: 89% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(31)
2:20.358 aoe o arcane_explosion Fluffy_Pillow 55822.0/63371: 88% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, thrill_seeker(32)
2:21.666 aoe o arcane_explosion Fluffy_Pillow 57479.8/63371: 91% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(32)
2:22.971 aoe p arcane_barrage Fluffy_Pillow 56633.8/63371: 89% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker(33)
2:24.277 aoe n arcane_orb Fluffy_Pillow 60823.9/63371: 96% mana arcane_power, clearcasting, rune_of_power, thrill_seeker(34)
2:25.585 aoe p arcane_barrage Fluffy_Pillow 62231.7/63371: 98% mana arcane_charge(4), clearcasting, thrill_seeker(34)
2:26.891 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, thrill_seeker(35)
2:28.197 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, thrill_seeker(36)
2:29.503 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge(2), thrill_seeker(36)
2:30.809 aoe o arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(3), thrill_seeker(37)
2:32.114 shared_cds r use_mana_gem Venthyr_Nadjia 53335.9/63371: 84% mana arcane_charge(4), thrill_seeker(38)
2:32.114 aoe p arcane_barrage Fluffy_Pillow 59673.1/63371: 94% mana arcane_charge(4), thrill_seeker(38)
2:33.419 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana thrill_seeker(38)
2:34.725 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, clearcasting, thrill_seeker(39)
2:36.032 aoe o arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2), euphoria
2:37.121 aoe o arcane_explosion Fluffy_Pillow 58063.4/63371: 92% mana arcane_charge(3), euphoria
2:38.210 aoe p arcane_barrage Fluffy_Pillow 54443.7/63371: 86% mana arcane_charge(4), thrill_seeker, euphoria
2:39.301 aoe j mirrors_of_torment Fluffy_Pillow 58361.3/63371: 92% mana thrill_seeker, euphoria
2:40.391 aoe k touch_of_the_magi Fluffy_Pillow 57742.8/63371: 91% mana thrill_seeker(3), euphoria
2:41.481 aoe m rune_of_power Fluffy_Pillow 56624.3/63371: 89% mana arcane_charge(4), thrill_seeker(3), euphoria
2:42.570 aoe p arcane_barrage Fluffy_Pillow 60539.4/63371: 96% mana arcane_charge(4), rune_of_power, thrill_seeker(4), euphoria
2:43.661 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, thrill_seeker(4), euphoria
2:44.751 aoe o arcane_explosion Fluffy_Pillow 59752.9/63371: 94% mana arcane_charge, rune_of_power, thrill_seeker(5), euphoria
2:45.840 aoe o arcane_explosion Fluffy_Pillow 56133.2/63371: 89% mana arcane_charge(2), rune_of_power, thrill_seeker(5), euphoria
2:46.930 aoe o arcane_explosion Fluffy_Pillow 52514.7/63371: 83% mana arcane_charge(3), rune_of_power, thrill_seeker(6)
2:48.237 aoe p arcane_barrage Fluffy_Pillow 51706.0/63371: 82% mana arcane_charge(4), rune_of_power, thrill_seeker(7)
2:49.544 aoe n arcane_orb Fluffy_Pillow 55897.4/63371: 88% mana rune_of_power, thrill_seeker(7)
2:50.852 aoe p arcane_barrage Fluffy_Pillow 57055.2/63371: 90% mana arcane_charge(4), rune_of_power, thrill_seeker(8)
2:52.159 aoe o arcane_explosion Fluffy_Pillow 61246.6/63371: 97% mana rune_of_power, thrill_seeker(9)
2:53.466 aoe o arcane_explosion Fluffy_Pillow 57903.1/63371: 91% mana arcane_charge, rune_of_power, thrill_seeker(9)
2:54.773 aoe o arcane_explosion Fluffy_Pillow 57094.5/63371: 90% mana arcane_charge(2), rune_of_power, thrill_seeker(10)
2:56.079 aoe o arcane_explosion Fluffy_Pillow 53749.8/63371: 85% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(11)
2:57.386 aoe p arcane_barrage Fluffy_Pillow 55406.3/63371: 87% mana arcane_charge(4), rune_of_power, thrill_seeker(11)
2:58.693 aoe o arcane_explosion Fluffy_Pillow 59597.7/63371: 94% mana thrill_seeker(12)
3:00.001 aoe o arcane_explosion Fluffy_Pillow 56255.5/63371: 89% mana arcane_charge, thrill_seeker(13)
3:01.306 aoe o arcane_explosion Fluffy_Pillow 52909.5/63371: 83% mana arcane_charge(2), thrill_seeker(13)
3:02.613 aoe o arcane_explosion Fluffy_Pillow 49566.0/63371: 78% mana arcane_charge(3), thrill_seeker(14)
3:03.921 aoe p arcane_barrage Fluffy_Pillow 46223.8/63371: 73% mana arcane_charge(4), thrill_seeker(14)
3:05.226 aoe o arcane_explosion Fluffy_Pillow 50412.7/63371: 80% mana thrill_seeker(15)
3:06.533 aoe o arcane_explosion Fluffy_Pillow 47069.2/63371: 74% mana arcane_charge, thrill_seeker(16)
3:07.840 aoe o arcane_explosion Fluffy_Pillow 43725.7/63371: 69% mana arcane_charge(2), thrill_seeker(16)
3:09.145 aoe o arcane_explosion Fluffy_Pillow 40379.7/63371: 64% mana arcane_charge(3), clearcasting, thrill_seeker(17)
3:10.450 aoe p arcane_barrage Fluffy_Pillow 42033.7/63371: 66% mana arcane_charge(4), thrill_seeker(18)
3:11.757 aoe n arcane_orb Fluffy_Pillow 46225.1/63371: 73% mana thrill_seeker(18)
3:13.064 aoe p arcane_barrage Fluffy_Pillow 47381.6/63371: 75% mana arcane_charge(4), thrill_seeker(19)
3:14.371 aoe o arcane_explosion Fluffy_Pillow 51573.0/63371: 81% mana thrill_seeker(20)
3:15.679 aoe o arcane_explosion Fluffy_Pillow 48230.8/63371: 76% mana arcane_charge, clearcasting, thrill_seeker(20)
3:16.987 aoe o arcane_explosion Fluffy_Pillow 49888.6/63371: 79% mana arcane_charge(2), thrill_seeker(21)
3:18.294 aoe o arcane_explosion Fluffy_Pillow 46545.1/63371: 73% mana arcane_charge(3), thrill_seeker(22)
3:19.600 aoe p arcane_barrage Fluffy_Pillow 43200.4/63371: 68% mana arcane_charge(4), clearcasting, thrill_seeker(22)
3:20.905 aoe o arcane_explosion Fluffy_Pillow 47389.3/63371: 75% mana clearcasting, thrill_seeker(23)
3:22.210 aoe o arcane_explosion Fluffy_Pillow 49043.2/63371: 77% mana arcane_charge, thrill_seeker(24)
3:23.518 aoe o arcane_explosion Fluffy_Pillow 45701.0/63371: 72% mana arcane_charge(2), thrill_seeker(24)
3:24.825 aoe o arcane_explosion Fluffy_Pillow 42357.6/63371: 67% mana arcane_charge(3), thrill_seeker(25)
3:26.132 aoe p arcane_barrage Fluffy_Pillow 39014.1/63371: 62% mana arcane_charge(4), thrill_seeker(26)
3:27.439 aoe k touch_of_the_magi Fluffy_Pillow 43205.5/63371: 68% mana thrill_seeker(26)
3:28.743 aoe m rune_of_power Fluffy_Pillow 42358.2/63371: 67% mana arcane_charge(4), thrill_seeker(27)
3:30.049 aoe p arcane_barrage Fluffy_Pillow 44013.5/63371: 69% mana arcane_charge(4), rune_of_power, thrill_seeker(28)
3:31.353 aoe o arcane_explosion Fluffy_Pillow 48201.1/63371: 76% mana rune_of_power, thrill_seeker(28)
3:32.662 aoe o arcane_explosion Fluffy_Pillow 44860.1/63371: 71% mana arcane_charge, clearcasting, rune_of_power, thrill_seeker(29)
3:33.969 aoe o arcane_explosion Fluffy_Pillow 46516.7/63371: 73% mana arcane_charge(2), rune_of_power, thrill_seeker(29)
3:35.273 aoe o arcane_explosion Fluffy_Pillow 43169.4/63371: 68% mana arcane_charge(3), rune_of_power, thrill_seeker(30)
3:36.580 aoe p arcane_barrage Fluffy_Pillow 39825.9/63371: 63% mana arcane_charge(4), rune_of_power, thrill_seeker(31)
3:37.887 aoe n arcane_orb Fluffy_Pillow 44017.3/63371: 69% mana rune_of_power, thrill_seeker(31)
3:39.193 aoe p arcane_barrage Fluffy_Pillow 45172.6/63371: 71% mana arcane_charge(4), rune_of_power, thrill_seeker(32)
3:40.500 aoe o arcane_explosion Fluffy_Pillow 49363.9/63371: 78% mana rune_of_power, thrill_seeker(33)
3:41.807 aoe o arcane_explosion Fluffy_Pillow 46020.5/63371: 73% mana arcane_charge, clearcasting, rune_of_power, thrill_seeker(33)
3:43.113 aoe o arcane_explosion Fluffy_Pillow 47675.7/63371: 75% mana arcane_charge(2), rune_of_power, thrill_seeker(34)
3:44.420 aoe o arcane_explosion Fluffy_Pillow 44332.3/63371: 70% mana arcane_charge(3), rune_of_power, thrill_seeker(35)
3:45.725 aoe p arcane_barrage Fluffy_Pillow 40986.3/63371: 65% mana arcane_charge(4), thrill_seeker(35)
3:47.033 aoe o arcane_explosion Fluffy_Pillow 45178.9/63371: 71% mana thrill_seeker(36)
3:48.341 aoe o arcane_explosion Fluffy_Pillow 41836.7/63371: 66% mana arcane_charge, clearcasting, thrill_seeker(37)
3:49.644 aoe o arcane_explosion Fluffy_Pillow 43488.2/63371: 69% mana arcane_charge(2), thrill_seeker(37)
3:50.949 aoe o arcane_explosion Fluffy_Pillow 40142.2/63371: 63% mana arcane_charge(3), thrill_seeker(38)
3:52.256 aoe p arcane_barrage Fluffy_Pillow 36798.7/63371: 58% mana arcane_charge(4), thrill_seeker(39)
3:53.562 aoe o arcane_explosion Fluffy_Pillow 40988.8/63371: 65% mana thrill_seeker(39)
3:54.869 aoe o arcane_explosion Fluffy_Pillow 37645.3/63371: 59% mana arcane_charge, euphoria
3:55.956 aoe o arcane_explosion Fluffy_Pillow 34023.0/63371: 54% mana arcane_charge(2), clearcasting, euphoria
3:57.044 aoe o arcane_explosion Fluffy_Pillow 35402.0/63371: 56% mana arcane_charge(3), thrill_seeker, euphoria
3:58.135 aoe p arcane_barrage Fluffy_Pillow 31784.8/63371: 50% mana arcane_charge(4), thrill_seeker(3), euphoria
3:59.225 aoe n arcane_orb Fluffy_Pillow 35701.1/63371: 56% mana thrill_seeker(3), euphoria
4:00.314 aoe p arcane_barrage Fluffy_Pillow 36581.3/63371: 58% mana arcane_charge(4), thrill_seeker(4), euphoria
4:01.405 aoe o arcane_explosion Fluffy_Pillow 40499.0/63371: 64% mana thrill_seeker(4), euphoria
4:02.495 aoe o arcane_explosion Fluffy_Pillow 36880.5/63371: 58% mana arcane_charge, thrill_seeker(5), euphoria
4:03.585 aoe o arcane_explosion Fluffy_Pillow 33262.0/63371: 52% mana arcane_charge(2), thrill_seeker(5), euphoria
4:04.673 aoe o arcane_explosion Fluffy_Pillow 29640.9/63371: 47% mana arcane_charge(3), clearcasting, thrill_seeker(6)
4:05.980 aoe p arcane_barrage Fluffy_Pillow 31297.5/63371: 49% mana arcane_charge(4), thrill_seeker(6)
4:07.286 aoe o arcane_explosion Fluffy_Pillow 35487.6/63371: 56% mana thrill_seeker(7)
4:08.593 aoe o arcane_explosion Fluffy_Pillow 32144.1/63371: 51% mana arcane_charge, thrill_seeker(8)
4:09.899 aoe o arcane_explosion Fluffy_Pillow 28799.4/63371: 45% mana arcane_charge(2), thrill_seeker(8)
4:11.206 aoe o arcane_explosion Fluffy_Pillow 25455.9/63371: 40% mana arcane_charge(3), thrill_seeker(9)
4:12.513 aoe p arcane_barrage Fluffy_Pillow 22112.4/63371: 35% mana arcane_charge(4), thrill_seeker(10)
4:13.820 aoe j mirrors_of_torment Fluffy_Pillow 26303.8/63371: 42% mana thrill_seeker(10)
4:15.125 aoe k touch_of_the_magi Fluffy_Pillow 25957.8/63371: 41% mana thrill_seeker(11)
4:16.432 aoe l arcane_power Fluffy_Pillow 25114.3/63371: 40% mana arcane_charge(4), thrill_seeker(12)
4:16.432 shared_cds t berserking Fluffy_Pillow 25114.3/63371: 40% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(12)
4:16.432 aoe p arcane_barrage Fluffy_Pillow 25114.3/63371: 40% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(12)
4:17.622 aoe o arcane_explosion Fluffy_Pillow 31692.3/63371: 50% mana berserking, arcane_power, rune_of_power, thrill_seeker(12)
4:18.811 aoe o arcane_explosion Fluffy_Pillow 30699.3/63371: 48% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(13)
4:20.000 aoe o arcane_explosion Fluffy_Pillow 29706.2/63371: 47% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(14)
4:21.190 aoe o arcane_explosion Fluffy_Pillow 28714.5/63371: 45% mana berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(14)
4:22.378 aoe p arcane_barrage Fluffy_Pillow 27720.2/63371: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(15)
4:23.567 aoe n arcane_orb Fluffy_Pillow 34296.9/63371: 54% mana berserking, arcane_power, rune_of_power, thrill_seeker(15)
4:24.755 aoe p arcane_barrage Fluffy_Pillow 35552.6/63371: 56% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(16)
4:25.942 aoe o arcane_explosion Fluffy_Pillow 39591.9/63371: 62% mana berserking, arcane_power, rune_of_power, thrill_seeker(16)
4:27.130 aoe o arcane_explosion Fluffy_Pillow 38597.6/63371: 61% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(17)
4:28.318 aoe o arcane_explosion Fluffy_Pillow 37603.3/63371: 59% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(18)
4:29.508 aoe o arcane_explosion Fluffy_Pillow 39146.4/63371: 62% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(18)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Nadjia"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=331586//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Theotar : 17005 dps, 4763 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17004.7 17004.7 27.6 / 0.162% 1708.0 / 10.0% 8.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2049.3 1963.2 Mana 0.00% 49.6 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 17005
Arcane Barrage 5817 34.3% 56.8 5.26sec 30643 24561 Direct 283.7 5161 10270 6141 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.82 283.73 0.00 0.00 1.2477 0.0000 1741138.64 1741138.64 0.00% 24560.79 24560.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 229.36 174 289 5161.43 2082 26974 5149.94 4567 5683 1183492 1183492 0.00%
crit 19.16% 54.37 32 79 10269.83 4164 53948 10238.30 7876 14003 557647 557647 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:56.83
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 452 2.7% 42.6 6.55sec 3173 0 Direct 212.9 532 1063 635 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.58 212.90 0.00 0.00 0.0000 0.0000 135109.62 135109.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 171.86 125 216 532.46 316 664 531.79 499 584 91487 91487 0.00%
crit 19.28% 41.04 19 68 1063.21 633 1329 1061.73 919 1186 43623 43623 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 8010 47.1% 153.2 1.92sec 15616 12572 Direct 766.1 2617 5239 3124 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.22 766.09 0.00 0.00 1.2422 0.0000 2392689.45 2392689.45 0.00% 12571.53 12571.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 618.00 479 757 2617.12 1958 4616 2616.95 2524 2751 1617077 1617077 0.00%
crit 19.33% 148.08 94 203 5239.03 3916 9232 5238.74 4779 5742 775612 775612 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:153.24
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1436) 0.0% (8.4%) 13.1 23.52sec 32794 26302

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.08 0.00 0.00 0.00 1.2469 0.0000 0.00 0.00 0.00% 26301.56 26301.56

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.08
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1436 8.4% 65.3 23.52sec 6572 0 Direct 65.3 5516 11059 6575 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.28 65.28 0.00 0.00 0.0000 0.0000 429031.03 429031.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 52.81 35 74 5516.06 3869 9122 5514.56 4716 6149 291207 291207 0.00%
crit 19.11% 12.47 3 27 11058.84 7739 18245 11052.01 8048 14893 137824 137824 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (70) 0.0% (0.4%) 14.8 1.75sec 1390 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 70 0.4% 14.8 1.75sec 1390 0 Direct 14.8 1164 2327 1390 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.75 14.75 0.00 0.00 0.0000 0.0000 20506.95 20506.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.51% 11.88 5 20 1163.53 1164 1164 1163.53 1164 1164 13818 13818 0.00%
crit 19.49% 2.87 0 9 2327.06 2327 2327 2228.77 0 2327 6689 6689 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1764 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1767.21 1767.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 0.81 0 1 1480.68 1481 1481 1194.14 0 1481 1194 1194 0.00%
crit 19.35% 0.19 0 1 2961.35 2961 2961 573.07 0 2961 573 573 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.1%) 1.0 0.00sec 6097 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 21 0.1% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6097.43 6097.43 0.00% 51.77 51.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 72.66 61 83 56.79 43 60 56.79 56 58 4126 4126 0.00%
crit 19.27% 17.34 7 29 113.64 86 120 113.65 103 120 1971 1971 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (144) 0.0% (0.9%) 2.7 138.15sec 16250 12439

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.66 0.00 0.00 0.00 1.3066 0.0000 0.00 0.00 0.00% 12438.75 12438.75

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.67
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 64 0.4% 5.3 54.90sec 3621 0 Direct 5.3 3044 6049 3620 19.2%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.25 5.25 0.00 0.00 0.0000 0.0000 19016.95 19016.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 4.24 1 6 3043.61 1739 3651 3022.50 1739 3651 12910 12910 0.00%
crit 19.21% 1.01 0 4 6049.27 3477 7302 3999.47 0 7302 6106 6106 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 81 0.5% 2.6 139.42sec 9477 0 Direct 2.6 7969 16055 9486 18.7%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.55 2.55 0.00 0.00 0.0000 0.0000 24195.28 24195.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.30% 2.08 0 3 7968.62 6126 9188 7740.16 0 9188 16541 16541 0.00%
crit 18.70% 0.48 0 2 16054.84 12251 18377 6426.40 0 18377 7654 7654 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (1048) 0.0% (6.2%) 6.0 52.97sec 51792 41207

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2569 0.0000 0.00 0.00 0.00% 41207.37 41207.37

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.06
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1048 6.2% 6.0 52.89sec 51792 0 Direct 30.1 10400 0 10400 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 30.13 0.00 0.00 0.0000 0.0000 313093.56 313093.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.13 25 35 10399.82 313 55826 10379.98 7229 13564 313094 313094 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19023.77
  • base_dd_max:19023.77
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Theotar
Arcane Power 2.8 129.50sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.82
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.99sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.82
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.8 172.45sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.81 0.00 4.83 0.00 4.3096 0.7223 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.81
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 51.45sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.85 0.00 0.00 0.00 1.2552 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.88
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.83sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.71
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.5 180.1 5.2sec 1.2sec 3.8sec 72.87% 0.00% 26.5 (26.6) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.64%
  • arcane_charge_2:16.33%
  • arcane_charge_3:16.43%
  • arcane_charge_4:21.47%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.4sec 129.4sec 14.7sec 13.78% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.7s / 137.6s
  • trigger_min/max:121.7s / 137.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.78%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.8sec 258.8sec 11.7sec 7.01% 23.45% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:252.8s / 264.3s
  • trigger_min/max:252.8s / 264.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.01%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.5 0.2 11.8sec 11.7sec 2.0sec 16.25% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.05%
  • clearcasting_2:0.21%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.8 0.0 169.2sec 169.2sec 4.3sec 1.17% 0.00% 3.2 (3.2) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:118.0s / 259.2s
  • trigger_min/max:118.0s / 259.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.17%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.48%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.7 0.0 35.9sec 35.9sec 14.7sec 42.49% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 56.6s
  • trigger_min/max:15.7s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.49%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Soothing Shade 4.1 0.0 63.2sec 63.2sec 11.8sec 16.15% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 209.4s
  • trigger_min/max:20.0s / 209.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.15%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.71% 0.77% 7.59% 0.8s 0.0s 6.0s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.911120.053239.917
Evocation183.23428.014353.588241.231139.844359.610
Rune of Power7.4211.14228.61245.81026.62058.975
Touch of the Magi5.8050.00027.33737.26325.31457.162
Arcane Power6.8661.67917.63619.7974.01626.629
Arcane Barrage2.7640.0039.579158.124124.773194.454
Arcane Orb3.4700.00010.48545.81932.44259.917
Mirrors of Torment29.5690.00074.52486.24157.519145.180

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
mana_regen Mana 516.08 374225.37 63.78% 725.13 12693.30 3.28%
Evocation Mana 38.53 39219.41 6.68% 1017.79 0.00 0.00%
Mana Gem Mana 2.71 17503.52 2.98% 6461.49 0.00 0.00%
Arcane Barrage Mana 56.83 139826.98 23.83% 2460.62 7440.85 5.05%
Mirrors of Torment Mana 7.81 15979.37 2.72% 2045.39 4244.13 20.99%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1963.22 2049.29 24385.8 37000.6 389.7 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
arcane_explosion Mana 153.2 585195.8 3818.9 3819.4 4.1
arcane_orb Mana 13.1 5854.4 447.5 447.5 73.3
mirrors_of_torment Mana 2.7 5321.1 2000.0 2001.1 8.1
touch_of_the_magi Mana 6.0 15111.2 2500.0 2499.7 20.7

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Venthyr_Theotar Damage Per Second
Count 1018
Mean 17004.67
Minimum 15628.82
Maximum 18588.02
Spread ( max - min ) 2959.20
Range [ ( max - min ) / 2 * 100% ] 8.70%
Standard Deviation 448.7685
5th Percentile 16293.96
95th Percentile 17736.18
( 95th Percentile - 5th Percentile ) 1442.22
Mean Distribution
Standard Deviation 14.0653
95.00% Confidence Interval ( 16977.10 - 17032.23 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2676
0.1 Scale Factor Error with Delta=300 1720
0.05 Scale Factor Error with Delta=300 6877
0.01 Scale Factor Error with Delta=300 171921
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 1018
Mean 4762.72
Minimum 4168.89
Maximum 5464.80
Spread ( max - min ) 1295.91
Range [ ( max - min ) / 2 * 100% ] 13.60%
Standard Deviation 191.8143
5th Percentile 4447.90
95th Percentile 5086.66
( 95th Percentile - 5th Percentile ) 638.76
Mean Distribution
Standard Deviation 6.0118
95.00% Confidence Interval ( 4750.94 - 4774.50 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 63
0.1% Error 6231
0.1 Scale Factor Error with Delta=300 315
0.05 Scale Factor Error with Delta=300 1257
0.01 Scale Factor Error with Delta=300 31409
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 1018
Mean 17004.67
Minimum 15628.82
Maximum 18588.02
Spread ( max - min ) 2959.20
Range [ ( max - min ) / 2 * 100% ] 8.70%
Damage
Venthyr_Theotar Damage
Count 1018
Mean 5076548.71
Minimum 3942943.84
Maximum 6185158.49
Spread ( max - min ) 2242214.65
Range [ ( max - min ) / 2 * 100% ] 22.08%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.67 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.06 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.82 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.88 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.08 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 153.24 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 56.83 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.81 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.71 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.82 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooropnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooolpoooopoooropnpoooopoooopjkmpnpoooopoooopoooopnpoooopoqooopnpkmpoooopoooopoooopnpoooopoooopoooopnpjkltproooopo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 61376.5/63371: 97% mana bloodlust
0:02.312 aoe l arcane_power Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, arcane_charge(4)
0:02.312 shared_cds s potion Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:02.312 shared_cds t berserking Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.312 aoe p arcane_barrage Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.227 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.142 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.056 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.970 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.884 aoe o arcane_explosion Fluffy_Pillow 69307.2/72371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:07.798 aoe o arcane_explosion Fluffy_Pillow 68130.2/72371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:08.712 aoe p arcane_barrage Fluffy_Pillow 66953.1/72371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:09.628 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:10.541 aoe o arcane_explosion Fluffy_Pillow 71192.9/72371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:11.454 aoe o arcane_explosion Fluffy_Pillow 70014.4/72371: 97% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:12.366 aoe o arcane_explosion Fluffy_Pillow 68834.5/72371: 95% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:13.280 aoe p arcane_barrage Fluffy_Pillow 67657.4/72371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:14.196 aoe o arcane_explosion Fluffy_Pillow 71878.1/72371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:15.109 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana bloodlust, arcane_charge, arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:16.115 aoe o arcane_explosion Fluffy_Pillow 71327.5/72371: 99% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:17.123 aoe o arcane_explosion Fluffy_Pillow 70286.5/72371: 97% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:18.131 aoe m rune_of_power Fluffy_Pillow 60634.3/63371: 96% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.138 aoe p arcane_barrage Fluffy_Pillow 61910.6/63371: 98% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.145 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.149 aoe o arcane_explosion Fluffy_Pillow 59643.9/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.156 aoe o arcane_explosion Fluffy_Pillow 55920.2/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.162 shared_cds r use_mana_gem Venthyr_Theotar 52195.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.162 aoe o arcane_explosion Fluffy_Pillow 58532.4/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.169 aoe p arcane_barrage Fluffy_Pillow 54808.7/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.175 aoe n arcane_orb Fluffy_Pillow 58618.6/63371: 93% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.182 aoe p arcane_barrage Fluffy_Pillow 59394.9/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.187 aoe o arcane_explosion Fluffy_Pillow 63203.5/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.194 aoe o arcane_explosion Fluffy_Pillow 59479.8/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power
0:29.198 aoe o arcane_explosion Fluffy_Pillow 60752.3/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power
0:30.205 aoe o arcane_explosion Fluffy_Pillow 57028.6/63371: 90% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power
0:31.211 aoe p arcane_barrage Fluffy_Pillow 58303.7/63371: 92% mana bloodlust, arcane_charge(4), rune_of_power
0:32.219 aoe o arcane_explosion Fluffy_Pillow 62116.1/63371: 98% mana bloodlust, rune_of_power
0:33.225 aoe o arcane_explosion Fluffy_Pillow 58391.1/63371: 92% mana bloodlust, arcane_charge, rune_of_power
0:34.231 aoe o arcane_explosion Fluffy_Pillow 54666.1/63371: 86% mana bloodlust, arcane_charge(2)
0:35.236 aoe o arcane_explosion Fluffy_Pillow 50939.9/63371: 80% mana bloodlust, arcane_charge(3)
0:36.242 aoe p arcane_barrage Fluffy_Pillow 47214.9/63371: 75% mana bloodlust, arcane_charge(4)
0:37.248 aoe o arcane_explosion Fluffy_Pillow 51024.8/63371: 81% mana bloodlust
0:38.255 aoe o arcane_explosion Fluffy_Pillow 47301.1/63371: 75% mana bloodlust, arcane_charge
0:39.260 aoe o arcane_explosion Fluffy_Pillow 43574.9/63371: 69% mana bloodlust, arcane_charge(2)
0:40.268 aoe o arcane_explosion Fluffy_Pillow 39852.5/63371: 63% mana bloodlust, arcane_charge(3), clearcasting
0:41.273 aoe p arcane_barrage Fluffy_Pillow 41126.2/63371: 65% mana arcane_charge(4)
0:42.581 aoe o arcane_explosion Fluffy_Pillow 45318.9/63371: 72% mana
0:43.887 aoe o arcane_explosion Fluffy_Pillow 41974.1/63371: 66% mana arcane_charge
0:45.194 aoe o arcane_explosion Fluffy_Pillow 38630.7/63371: 61% mana arcane_charge(2)
0:46.501 aoe o arcane_explosion Fluffy_Pillow 35287.2/63371: 56% mana arcane_charge(3), clearcasting
0:47.808 aoe p arcane_barrage Fluffy_Pillow 36943.7/63371: 58% mana arcane_charge(4)
0:49.116 aoe n arcane_orb Fluffy_Pillow 41136.4/63371: 65% mana
0:50.423 aoe p arcane_barrage Fluffy_Pillow 42292.9/63371: 67% mana arcane_charge(4)
0:51.730 aoe o arcane_explosion Fluffy_Pillow 46484.3/63371: 73% mana
0:53.038 aoe o arcane_explosion Fluffy_Pillow 43142.1/63371: 68% mana arcane_charge
0:54.345 aoe o arcane_explosion Fluffy_Pillow 39798.6/63371: 63% mana arcane_charge(2)
0:55.654 aoe o arcane_explosion Fluffy_Pillow 36457.7/63371: 58% mana arcane_charge(3), clearcasting
0:56.959 aoe p arcane_barrage Fluffy_Pillow 38111.7/63371: 60% mana arcane_charge(4)
0:58.264 aoe o arcane_explosion Fluffy_Pillow 42300.5/63371: 67% mana
0:59.571 aoe o arcane_explosion Fluffy_Pillow 38957.1/63371: 61% mana arcane_charge
1:00.877 aoe o arcane_explosion Fluffy_Pillow 35612.3/63371: 56% mana arcane_charge(2)
1:02.183 aoe o arcane_explosion Fluffy_Pillow 32267.6/63371: 51% mana arcane_charge(3), clearcasting
1:03.489 aoe p arcane_barrage Fluffy_Pillow 33922.9/63371: 54% mana arcane_charge(4)
1:04.797 aoe k touch_of_the_magi Fluffy_Pillow 38115.5/63371: 60% mana
1:06.104 aoe m rune_of_power Fluffy_Pillow 37272.0/63371: 59% mana arcane_charge(4)
1:07.410 aoe p arcane_barrage Fluffy_Pillow 38927.3/63371: 61% mana arcane_charge(4), rune_of_power
1:08.715 aoe o arcane_explosion Fluffy_Pillow 43116.1/63371: 68% mana rune_of_power
1:10.021 aoe o arcane_explosion Fluffy_Pillow 39771.4/63371: 63% mana arcane_charge, rune_of_power
1:11.329 aoe o arcane_explosion Fluffy_Pillow 36429.2/63371: 57% mana arcane_charge(2), rune_of_power
1:12.636 aoe o arcane_explosion Fluffy_Pillow 33085.7/63371: 52% mana arcane_charge(3), rune_of_power
1:13.942 aoe p arcane_barrage Fluffy_Pillow 29741.0/63371: 47% mana arcane_charge(4), rune_of_power
1:15.250 aoe n arcane_orb Fluffy_Pillow 33933.7/63371: 54% mana rune_of_power
1:16.557 aoe p arcane_barrage Fluffy_Pillow 35090.2/63371: 55% mana arcane_charge(4), rune_of_power
1:17.863 aoe o arcane_explosion Fluffy_Pillow 39280.3/63371: 62% mana rune_of_power
1:19.168 aoe o arcane_explosion Fluffy_Pillow 35934.3/63371: 57% mana arcane_charge, clearcasting, rune_of_power
1:20.473 aoe o arcane_explosion Fluffy_Pillow 37588.3/63371: 59% mana arcane_charge(2), rune_of_power
1:21.781 aoe o arcane_explosion Fluffy_Pillow 34246.1/63371: 54% mana arcane_charge(3), rune_of_power
1:23.086 aoe p arcane_barrage Fluffy_Pillow 30900.1/63371: 49% mana arcane_charge(4)
1:24.391 aoe o arcane_explosion Fluffy_Pillow 35088.9/63371: 55% mana
1:25.697 aoe o arcane_explosion Fluffy_Pillow 31744.2/63371: 50% mana arcane_charge
1:27.003 aoe o arcane_explosion Fluffy_Pillow 28399.5/63371: 45% mana arcane_charge(2)
1:28.310 aoe o arcane_explosion Fluffy_Pillow 25056.0/63371: 40% mana arcane_charge(3)
1:29.617 aoe p arcane_barrage Fluffy_Pillow 21712.5/63371: 34% mana arcane_charge(4)
1:30.925 aoe o arcane_explosion Fluffy_Pillow 25905.2/63371: 41% mana
1:32.230 aoe o arcane_explosion Fluffy_Pillow 22559.2/63371: 36% mana arcane_charge
1:33.536 aoe o arcane_explosion Fluffy_Pillow 19214.4/63371: 30% mana arcane_charge(2)
1:34.841 aoe o arcane_explosion Fluffy_Pillow 15868.4/63371: 25% mana arcane_charge(3)
1:36.148 aoe p arcane_barrage Fluffy_Pillow 12524.9/63371: 20% mana arcane_charge(4)
1:37.454 aoe n arcane_orb Fluffy_Pillow 16715.1/63371: 26% mana
1:38.761 aoe p arcane_barrage Fluffy_Pillow 17871.6/63371: 28% mana arcane_charge(4)
1:40.069 aoe o arcane_explosion Fluffy_Pillow 22064.2/63371: 35% mana
1:41.375 aoe o arcane_explosion Fluffy_Pillow 18719.5/63371: 30% mana arcane_charge
1:42.681 aoe o arcane_explosion Fluffy_Pillow 15374.8/63371: 24% mana arcane_charge(2), clearcasting
1:43.988 aoe o arcane_explosion Fluffy_Pillow 17031.3/63371: 27% mana arcane_charge(3)
1:45.297 aoe p arcane_barrage Fluffy_Pillow 13690.4/63371: 22% mana arcane_charge(4)
1:46.603 aoe o arcane_explosion Fluffy_Pillow 17880.5/63371: 28% mana
1:47.909 aoe o arcane_explosion Fluffy_Pillow 14535.7/63371: 23% mana arcane_charge
1:49.216 aoe o arcane_explosion Fluffy_Pillow 11192.3/63371: 18% mana arcane_charge(2)
1:50.522 aoe o arcane_explosion Fluffy_Pillow 7847.5/63371: 12% mana arcane_charge(3)
1:51.827 aoe p arcane_barrage Fluffy_Pillow 4501.5/63371: 7% mana arcane_charge(4)
1:53.132 aoe k touch_of_the_magi Fluffy_Pillow 8690.4/63371: 14% mana
1:54.438 aoe m rune_of_power Fluffy_Pillow 8959.9/72371: 12% mana arcane_charge(4), soothing_shade
1:55.743 aoe p arcane_barrage Fluffy_Pillow 10848.8/72371: 15% mana arcane_charge(4), rune_of_power, soothing_shade
1:57.051 aoe o arcane_explosion Fluffy_Pillow 15636.9/72371: 22% mana rune_of_power, soothing_shade
1:58.359 aoe o arcane_explosion Fluffy_Pillow 12530.1/72371: 17% mana arcane_charge, rune_of_power, soothing_shade
1:59.665 aoe o arcane_explosion Fluffy_Pillow 9420.4/72371: 13% mana arcane_charge(2), rune_of_power, soothing_shade
2:00.974 aoe o arcane_explosion Fluffy_Pillow 6315.1/72371: 9% mana arcane_charge(3), rune_of_power, soothing_shade
2:02.283 aoe p arcane_barrage Fluffy_Pillow 3209.8/72371: 4% mana arcane_charge(4), clearcasting, rune_of_power, soothing_shade
2:03.589 aoe n arcane_orb Fluffy_Pillow 7995.0/72371: 11% mana clearcasting, rune_of_power, soothing_shade
2:04.896 aoe p arcane_barrage Fluffy_Pillow 9386.8/72371: 13% mana arcane_charge(4), clearcasting, rune_of_power, soothing_shade
2:06.201 aoe o arcane_explosion Fluffy_Pillow 14170.6/72371: 20% mana clearcasting, rune_of_power, soothing_shade
2:07.508 aoe o arcane_explosion Fluffy_Pillow 14064.9/63371: 22% mana arcane_charge, rune_of_power
2:08.814 aoe o arcane_explosion Fluffy_Pillow 10720.1/63371: 17% mana arcane_charge(2), rune_of_power
2:10.121 aoe o arcane_explosion Fluffy_Pillow 7376.6/63371: 12% mana arcane_charge(3), rune_of_power
2:11.426 aoe l arcane_power Fluffy_Pillow 4030.6/63371: 6% mana arcane_charge(4)
2:11.426 aoe p arcane_barrage Fluffy_Pillow 4030.6/63371: 6% mana arcane_charge(4), arcane_power, rune_of_power
2:12.733 aoe o arcane_explosion Fluffy_Pillow 8222.0/63371: 13% mana arcane_power, rune_of_power
2:14.041 aoe o arcane_explosion Fluffy_Pillow 7379.8/63371: 12% mana arcane_charge, arcane_power, clearcasting, rune_of_power
2:15.347 aoe o arcane_explosion Fluffy_Pillow 9035.1/63371: 14% mana arcane_charge(2), arcane_power, rune_of_power
2:16.653 aoe o arcane_explosion Fluffy_Pillow 8190.3/63371: 13% mana arcane_charge(3), arcane_power, rune_of_power
2:17.961 aoe p arcane_barrage Fluffy_Pillow 7348.1/63371: 12% mana arcane_charge(4), arcane_power, rune_of_power
2:19.268 aoe o arcane_explosion Fluffy_Pillow 11539.5/63371: 18% mana arcane_power, rune_of_power
2:20.574 aoe o arcane_explosion Fluffy_Pillow 10694.8/63371: 17% mana arcane_charge, arcane_power, rune_of_power
2:21.880 aoe o arcane_explosion Fluffy_Pillow 9850.1/63371: 16% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power
2:23.186 shared_cds r use_mana_gem Venthyr_Theotar 11505.3/63371: 18% mana arcane_charge(3), arcane_power, rune_of_power
2:23.186 aoe o arcane_explosion Fluffy_Pillow 17842.5/63371: 28% mana arcane_charge(3), arcane_power, rune_of_power
2:24.490 aoe p arcane_barrage Fluffy_Pillow 16995.2/63371: 27% mana arcane_charge(4), arcane_power, rune_of_power
2:25.797 aoe n arcane_orb Fluffy_Pillow 21186.6/63371: 33% mana arcane_power, rune_of_power
2:27.103 aoe p arcane_barrage Fluffy_Pillow 22591.8/63371: 36% mana arcane_charge(4)
2:28.409 aoe o arcane_explosion Fluffy_Pillow 26781.9/63371: 42% mana
2:29.715 aoe o arcane_explosion Fluffy_Pillow 23437.2/63371: 37% mana arcane_charge
2:31.021 aoe o arcane_explosion Fluffy_Pillow 20092.5/63371: 32% mana arcane_charge(2)
2:32.328 aoe o arcane_explosion Fluffy_Pillow 16749.0/63371: 26% mana arcane_charge(3)
2:33.634 aoe p arcane_barrage Fluffy_Pillow 13404.3/63371: 21% mana arcane_charge(4)
2:34.940 aoe o arcane_explosion Fluffy_Pillow 17594.4/63371: 28% mana
2:36.247 aoe o arcane_explosion Fluffy_Pillow 14250.9/63371: 22% mana arcane_charge
2:37.552 aoe o arcane_explosion Fluffy_Pillow 10904.9/63371: 17% mana arcane_charge(2), clearcasting
2:38.860 aoe o arcane_explosion Fluffy_Pillow 12562.7/63371: 20% mana arcane_charge(3)
2:40.165 aoe p arcane_barrage Fluffy_Pillow 9216.7/63371: 15% mana arcane_charge(4)
2:41.471 aoe j mirrors_of_torment Fluffy_Pillow 15310.8/72371: 21% mana soothing_shade
2:42.778 aoe k touch_of_the_magi Fluffy_Pillow 15202.6/72371: 21% mana soothing_shade
2:44.085 aoe m rune_of_power Fluffy_Pillow 14594.4/72371: 20% mana arcane_charge(4), soothing_shade
2:45.392 aoe p arcane_barrage Fluffy_Pillow 19381.1/72371: 27% mana arcane_charge(4), rune_of_power, soothing_shade
2:46.699 aoe n arcane_orb Fluffy_Pillow 24167.7/72371: 33% mana rune_of_power, soothing_shade
2:48.005 aoe p arcane_barrage Fluffy_Pillow 25558.1/72371: 35% mana arcane_charge(4), rune_of_power, soothing_shade
2:49.311 aoe o arcane_explosion Fluffy_Pillow 30343.3/72371: 42% mana rune_of_power, soothing_shade
2:50.616 aoe o arcane_explosion Fluffy_Pillow 30127.0/72371: 42% mana arcane_charge, rune_of_power, soothing_shade
2:51.923 aoe o arcane_explosion Fluffy_Pillow 27018.8/72371: 37% mana arcane_charge(2), rune_of_power, soothing_shade
2:53.229 aoe o arcane_explosion Fluffy_Pillow 20935.8/63371: 33% mana arcane_charge(3), rune_of_power
2:54.536 aoe p arcane_barrage Fluffy_Pillow 17592.4/63371: 28% mana arcane_charge(4), rune_of_power
2:55.843 aoe o arcane_explosion Fluffy_Pillow 21783.8/63371: 34% mana rune_of_power
2:57.149 aoe o arcane_explosion Fluffy_Pillow 20973.9/63371: 33% mana arcane_charge, rune_of_power
2:58.457 aoe o arcane_explosion Fluffy_Pillow 17631.7/63371: 28% mana arcane_charge(2), rune_of_power
2:59.762 aoe o arcane_explosion Fluffy_Pillow 14285.7/63371: 23% mana arcane_charge(3), rune_of_power
3:01.069 aoe p arcane_barrage Fluffy_Pillow 10942.2/63371: 17% mana arcane_charge(4)
3:02.377 aoe o arcane_explosion Fluffy_Pillow 15134.8/63371: 24% mana
3:03.681 aoe o arcane_explosion Fluffy_Pillow 11787.6/63371: 19% mana arcane_charge
3:04.988 aoe o arcane_explosion Fluffy_Pillow 8444.1/63371: 13% mana arcane_charge(2)
3:06.293 aoe o arcane_explosion Fluffy_Pillow 5098.1/63371: 8% mana arcane_charge(3), clearcasting
3:07.600 aoe p arcane_barrage Fluffy_Pillow 6754.6/63371: 11% mana arcane_charge(4)
3:08.906 aoe n arcane_orb Fluffy_Pillow 10944.7/63371: 17% mana
3:10.212 aoe p arcane_barrage Fluffy_Pillow 12100.0/63371: 19% mana arcane_charge(4)
3:11.520 aoe o arcane_explosion Fluffy_Pillow 16292.7/63371: 26% mana
3:12.826 aoe o arcane_explosion Fluffy_Pillow 12947.9/63371: 20% mana arcane_charge
3:14.135 aoe o arcane_explosion Fluffy_Pillow 9607.0/63371: 15% mana arcane_charge(2)
3:15.441 aoe o arcane_explosion Fluffy_Pillow 6262.2/63371: 10% mana arcane_charge(3)
3:16.748 aoe p arcane_barrage Fluffy_Pillow 2918.8/63371: 5% mana arcane_charge(4)
3:18.054 aoe o arcane_explosion Fluffy_Pillow 7108.9/63371: 11% mana
3:19.359 aoe q evocation Venthyr_Theotar 3762.9/63371: 6% mana arcane_charge
3:23.703 aoe o arcane_explosion Fluffy_Pillow 57607.6/63371: 91% mana arcane_charge
3:25.009 aoe o arcane_explosion Fluffy_Pillow 54262.8/63371: 86% mana arcane_charge(2), clearcasting
3:26.318 aoe o arcane_explosion Fluffy_Pillow 55921.9/63371: 88% mana arcane_charge(3)
3:27.623 aoe p arcane_barrage Fluffy_Pillow 52575.9/63371: 83% mana arcane_charge(4)
3:28.930 aoe n arcane_orb Fluffy_Pillow 56767.3/63371: 90% mana
3:30.235 aoe p arcane_barrage Fluffy_Pillow 57921.3/63371: 91% mana arcane_charge(4)
3:31.541 aoe k touch_of_the_magi Fluffy_Pillow 62111.4/63371: 98% mana
3:32.848 aoe m rune_of_power Fluffy_Pillow 60877.8/63371: 96% mana arcane_charge(4)
3:34.155 aoe p arcane_barrage Fluffy_Pillow 62534.3/63371: 99% mana arcane_charge(4), rune_of_power
3:35.461 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
3:36.767 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, clearcasting, rune_of_power
3:38.073 aoe o arcane_explosion Fluffy_Pillow 61682.0/63371: 97% mana arcane_charge(2), rune_of_power
3:39.380 aoe o arcane_explosion Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(3), rune_of_power
3:40.687 aoe p arcane_barrage Fluffy_Pillow 54995.0/63371: 87% mana arcane_charge(4), clearcasting, rune_of_power
3:41.994 aoe o arcane_explosion Fluffy_Pillow 59186.4/63371: 93% mana clearcasting, rune_of_power
3:43.302 aoe o arcane_explosion Fluffy_Pillow 69485.3/72371: 96% mana arcane_charge, rune_of_power, soothing_shade
3:44.608 aoe o arcane_explosion Fluffy_Pillow 66375.6/72371: 92% mana arcane_charge(2), rune_of_power, soothing_shade
3:45.913 aoe o arcane_explosion Fluffy_Pillow 63264.5/72371: 87% mana arcane_charge(3), rune_of_power, soothing_shade
3:47.219 aoe p arcane_barrage Fluffy_Pillow 60154.9/72371: 83% mana arcane_charge(4), rune_of_power, soothing_shade
3:48.524 aoe o arcane_explosion Fluffy_Pillow 64938.6/72371: 90% mana rune_of_power, soothing_shade
3:49.831 aoe o arcane_explosion Fluffy_Pillow 61830.4/72371: 85% mana arcane_charge, soothing_shade
3:51.139 aoe o arcane_explosion Fluffy_Pillow 58723.6/72371: 81% mana arcane_charge(2), soothing_shade
3:52.444 aoe o arcane_explosion Fluffy_Pillow 55612.5/72371: 77% mana arcane_charge(3), soothing_shade
3:53.749 aoe p arcane_barrage Fluffy_Pillow 52501.4/72371: 73% mana arcane_charge(4), clearcasting, soothing_shade
3:55.056 aoe n arcane_orb Fluffy_Pillow 50163.8/63371: 79% mana clearcasting
3:56.363 aoe p arcane_barrage Fluffy_Pillow 51320.3/63371: 81% mana arcane_charge(4), clearcasting
3:57.669 aoe o arcane_explosion Fluffy_Pillow 55510.5/63371: 88% mana clearcasting
3:58.974 aoe o arcane_explosion Fluffy_Pillow 57164.5/63371: 90% mana arcane_charge
4:00.280 aoe o arcane_explosion Fluffy_Pillow 53819.7/63371: 85% mana arcane_charge(2)
4:01.589 aoe o arcane_explosion Fluffy_Pillow 50478.8/63371: 80% mana arcane_charge(3)
4:02.894 aoe p arcane_barrage Fluffy_Pillow 47132.8/63371: 74% mana arcane_charge(4)
4:04.200 aoe o arcane_explosion Fluffy_Pillow 51322.9/63371: 81% mana
4:05.508 aoe o arcane_explosion Fluffy_Pillow 47980.7/63371: 76% mana arcane_charge
4:06.816 aoe o arcane_explosion Fluffy_Pillow 44638.5/63371: 70% mana arcane_charge(2), clearcasting
4:08.122 aoe o arcane_explosion Fluffy_Pillow 46293.7/63371: 73% mana arcane_charge(3)
4:09.428 aoe p arcane_barrage Fluffy_Pillow 42949.0/63371: 68% mana arcane_charge(4)
4:10.735 aoe o arcane_explosion Fluffy_Pillow 47140.4/63371: 74% mana
4:12.043 aoe o arcane_explosion Fluffy_Pillow 43798.2/63371: 69% mana arcane_charge
4:13.348 aoe o arcane_explosion Fluffy_Pillow 40452.2/63371: 64% mana arcane_charge(2), clearcasting
4:14.655 aoe o arcane_explosion Fluffy_Pillow 42108.7/63371: 66% mana arcane_charge(3)
4:15.962 aoe p arcane_barrage Fluffy_Pillow 38765.2/63371: 61% mana arcane_charge(4)
4:17.269 aoe n arcane_orb Fluffy_Pillow 42956.6/63371: 68% mana
4:18.576 aoe p arcane_barrage Fluffy_Pillow 44113.2/63371: 70% mana arcane_charge(4)
4:19.883 aoe j mirrors_of_torment Fluffy_Pillow 48304.5/63371: 76% mana
4:21.189 aoe k touch_of_the_magi Fluffy_Pillow 47959.8/63371: 76% mana
4:22.497 aoe l arcane_power Fluffy_Pillow 47117.6/63371: 74% mana arcane_charge(4)
4:22.497 shared_cds t berserking Fluffy_Pillow 47117.6/63371: 74% mana arcane_charge(4), arcane_power, rune_of_power
4:22.497 aoe p arcane_barrage Fluffy_Pillow 47117.6/63371: 74% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:23.684 shared_cds r use_mana_gem Venthyr_Theotar 53691.8/63371: 85% mana berserking, arcane_power, rune_of_power
4:23.684 aoe o arcane_explosion Fluffy_Pillow 60028.9/63371: 95% mana berserking, arcane_power, rune_of_power
4:24.873 aoe o arcane_explosion Fluffy_Pillow 59035.9/63371: 93% mana berserking, arcane_charge, arcane_power, rune_of_power
4:26.062 aoe o arcane_explosion Fluffy_Pillow 58042.8/63371: 92% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:27.251 aoe o arcane_explosion Fluffy_Pillow 57049.8/63371: 90% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power
4:28.441 aoe p arcane_barrage Fluffy_Pillow 58558.1/63371: 92% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:29.630 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Theotar"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=336239//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

arcane : 16287 dps, 4444 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16287.3 16287.3 25.1 / 0.154% 1530.2 / 9.4% 7.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
2051.5 1950.5 Mana 0.00% 49.4 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 16287
Arcane Barrage 5801 35.7% 57.0 5.26sec 30435 24496 Direct 284.7 5118 10214 6098 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.03 284.72 0.00 0.00 1.2424 0.0000 1735722.34 1735722.34 0.00% 24496.13 24496.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 229.96 170 292 5117.73 2082 25140 5106.88 4479 5630 1176243 1176243 0.00%
crit 19.23% 54.76 30 81 10213.58 4164 50280 10203.63 7372 14566 559479 559479 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:57.03
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 389 2.4% 36.6 7.67sec 3171 0 Direct 183.1 532 1062 634 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.62 183.11 0.00 0.00 0.0000 0.0000 116133.06 116133.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 147.77 107 195 532.04 443 664 531.45 493 555 78605 78605 0.00%
crit 19.30% 35.34 16 56 1062.20 886 1329 1061.19 941 1193 37528 37528 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7909 48.5% 154.3 1.91sec 15312 12324 Direct 771.4 2567 5136 3063 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.29 771.43 0.00 0.00 1.2425 0.0000 2362423.52 2362423.52 0.00% 12323.80 12323.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 622.43 485 762 2566.71 1958 4112 2566.86 2489 2649 1597259 1597259 0.00%
crit 19.31% 149.00 94 203 5135.59 3916 8223 5136.75 4801 5508 765165 765165 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:154.31
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1419) 0.0% (8.7%) 13.1 23.64sec 32494 26064

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.05 0.00 0.00 0.00 1.2467 0.0000 0.00 0.00 0.00% 26064.39 26064.39

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.05
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1419 8.7% 65.2 23.64sec 6510 0 Direct 65.2 5462 10953 6513 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.15 65.15 0.00 0.00 0.0000 0.0000 424145.86 424145.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 52.69 35 70 5461.55 3869 8126 5459.61 4834 5897 287681 287681 0.00%
crit 19.12% 12.46 3 24 10952.74 7739 16251 10955.55 8083 15168 136465 136465 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.5 1.74sec 1391 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.53 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.5 1.74sec 1391 0 Direct 14.5 1164 2327 1391 19.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.53 14.53 0.00 0.00 0.0000 0.0000 20214.36 20214.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 11.69 4 21 1163.53 1164 1164 1163.53 1164 1164 13601 13601 0.00%
crit 19.56% 2.84 0 9 2327.06 2327 2327 2199.05 0 2327 6613 6613 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1773 19.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1771.58 1771.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.35% 0.80 0 1 1480.68 1481 1481 1189.78 0 1481 1190 1190 0.00%
crit 19.65% 0.20 0 1 2961.35 2961 2961 581.80 0 2961 582 582 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 6033 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.1% 90.0 1.29sec 67 51 Direct 90.0 56 113 67 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6032.76 6032.76 0.00% 51.22 51.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 72.71 59 83 56.22 43 60 56.22 55 57 4088 4088 0.00%
crit 19.21% 17.29 7 31 112.51 86 120 112.48 101 120 1945 1945 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (673) 0.0% (4.1%) 6.1 52.45sec 32911 25190

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.11 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 25189.91 25189.91

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.13
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 673 4.1% 6.1 52.32sec 32911 0 Direct 30.4 6609 0 6609 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.11 30.45 0.00 0.00 0.0000 0.0000 201116.25 201116.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.45 25 35 6608.75 1576 37031 6595.83 4533 9025 201116 201116 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:13361.24
  • base_dd_max:13361.24
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.8 128.41sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.85
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 256.69sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [s]:1.85
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 182.84sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.21 0.00 7.19 0.00 4.3021 0.7220 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.21
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [r]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.9 51.03sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.90 0.00 0.00 0.00 1.2556 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:5.93
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.35sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [q]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.8 180.8 5.2sec 1.2sec 3.8sec 74.02% 0.00% 26.9 (27.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.3s
  • trigger_min/max:0.0s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.08%
  • arcane_charge_2:16.45%
  • arcane_charge_3:16.93%
  • arcane_charge_4:21.57%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.4sec 128.4sec 14.6sec 13.95% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.8s / 136.7s
  • trigger_min/max:120.8s / 136.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.95%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 256.7sec 256.7sec 11.6sec 7.14% 23.71% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.9s / 265.7s
  • trigger_min/max:253.9s / 265.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.14%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.57% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.57%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.4 0.1 11.9sec 11.8sec 1.9sec 15.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.52%
  • clearcasting_2:0.13%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.2 0.0 174.0sec 174.0sec 4.3sec 1.74% 0.00% 4.8 (4.8) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:101.0s / 256.5s
  • trigger_min/max:101.0s / 256.5s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:1.74%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.48%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.7 0.0 35.6sec 35.6sec 14.7sec 42.98% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 52.7s
  • trigger_min/max:15.7s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.98%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.03% 0.77% 6.48% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 298.9s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000178.911120.053239.917
Evocation139.19611.042323.521209.896134.602359.855
Rune of Power6.8340.02127.31042.86823.99958.604
Touch of the Magi5.0590.00027.31033.26922.39456.998
Arcane Power5.9180.77116.74317.1079.22127.018
Arcane Barrage2.7470.0008.280157.833126.572192.076
Arcane Orb3.5270.00810.48846.37133.73466.716

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 488.82 368878.61 63.27% 754.63 9339.15 2.47%
Evocation Mana 57.57 57876.79 9.93% 1005.39 0.00 0.00%
Mana Gem Mana 2.74 17356.66 2.98% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.03 138925.70 23.83% 2436.05 5634.70 3.90%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1950.48 2051.48 15008.0 33181.4 68.1 63371.4
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 154.3 591189.6 3831.2 3831.8 4.0
arcane_orb Mana 13.1 5826.6 446.4 446.4 72.8
touch_of_the_magi Mana 6.1 15273.2 2500.0 2499.3 13.2

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
arcane Damage Per Second
Count 1018
Mean 16287.26
Minimum 15217.48
Maximum 17312.67
Spread ( max - min ) 2095.18
Range [ ( max - min ) / 2 * 100% ] 6.43%
Standard Deviation 408.1220
5th Percentile 15643.16
95th Percentile 16990.18
( 95th Percentile - 5th Percentile ) 1347.02
Mean Distribution
Standard Deviation 12.7913
95.00% Confidence Interval ( 16262.19 - 16312.33 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2413
0.1 Scale Factor Error with Delta=300 1422
0.05 Scale Factor Error with Delta=300 5688
0.01 Scale Factor Error with Delta=300 142189
Priority Target DPS
arcane Priority Target Damage Per Second
Count 1018
Mean 4443.71
Minimum 3960.84
Maximum 5033.46
Spread ( max - min ) 1072.62
Range [ ( max - min ) / 2 * 100% ] 12.07%
Standard Deviation 172.0548
5th Percentile 4169.18
95th Percentile 4740.18
( 95th Percentile - 5th Percentile ) 571.01
Mean Distribution
Standard Deviation 5.3925
95.00% Confidence Interval ( 4433.14 - 4454.28 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 58
0.1% Error 5759
0.1 Scale Factor Error with Delta=300 253
0.05 Scale Factor Error with Delta=300 1011
0.01 Scale Factor Error with Delta=300 25271
DPS(e)
arcane Damage Per Second (Effective)
Count 1018
Mean 16287.26
Minimum 15217.48
Maximum 17312.67
Spread ( max - min ) 2095.18
Range [ ( max - min ) / 2 * 100% ] 6.43%
Damage
arcane Damage
Count 1018
Mean 4861526.96
Minimum 3772942.01
Maximum 5934087.88
Spread ( max - min ) 2161145.86
Range [ ( max - min ) / 2 * 100% ] 22.23%
DTPS
arcane Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.13 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.85 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 5.93 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.05 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 154.31 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 57.03 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.21 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
q 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
r 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
s 1.85 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkrsomonnnnonnnnonnnnlonnqnnomonnnnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnpjlomonnnnonnnnkonnnnomonnnnonnnnonnqnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojksomonnnnonnn

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask arcane 63371.4/63371: 100% mana
Pre precombat R food arcane 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.308 aoe k arcane_power Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4)
0:01.308 shared_cds r potion Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.308 shared_cds s berserking Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.308 aoe o arcane_barrage Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.222 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.137 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.052 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.965 aoe n arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.879 aoe n arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.793 aoe n arcane_explosion Fluffy_Pillow 59345.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.708 aoe o arcane_barrage Fluffy_Pillow 58005.1/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.622 aoe n arcane_explosion Fluffy_Pillow 61698.4/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.536 aoe n arcane_explosion Fluffy_Pillow 60356.9/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.451 aoe n arcane_explosion Fluffy_Pillow 59016.6/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.366 aoe n arcane_explosion Fluffy_Pillow 57676.3/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.279 aoe o arcane_barrage Fluffy_Pillow 56333.4/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.193 aoe n arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.108 aoe n arcane_explosion Fluffy_Pillow 58686.4/63371: 93% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.117 aoe n arcane_explosion Fluffy_Pillow 57465.2/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.124 aoe n arcane_explosion Fluffy_Pillow 56241.5/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.131 aoe l rune_of_power Fluffy_Pillow 55017.8/63371: 87% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.137 aoe o arcane_barrage Fluffy_Pillow 56292.9/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.142 aoe n arcane_explosion Fluffy_Pillow 60101.5/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.147 aoe n arcane_explosion Fluffy_Pillow 56375.3/63371: 89% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.154 shared_cds q use_mana_gem arcane 52651.6/63371: 83% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:21.154 aoe n arcane_explosion Fluffy_Pillow 58988.7/63371: 93% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.160 aoe n arcane_explosion Fluffy_Pillow 55263.7/63371: 87% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.167 aoe o arcane_barrage Fluffy_Pillow 51540.0/63371: 81% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.172 aoe m arcane_orb Fluffy_Pillow 55348.7/63371: 87% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.177 aoe o arcane_barrage Fluffy_Pillow 56122.4/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.183 aoe n arcane_explosion Fluffy_Pillow 59932.3/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.189 aoe n arcane_explosion Fluffy_Pillow 56207.4/63371: 89% mana bloodlust, arcane_charge, rune_of_power
0:28.196 aoe n arcane_explosion Fluffy_Pillow 52483.7/63371: 83% mana bloodlust, arcane_charge(2), rune_of_power
0:29.205 aoe n arcane_explosion Fluffy_Pillow 48762.5/63371: 77% mana bloodlust, arcane_charge(3), rune_of_power
0:30.211 aoe o arcane_barrage Fluffy_Pillow 45037.5/63371: 71% mana bloodlust, arcane_charge(4), rune_of_power
0:31.218 aoe n arcane_explosion Fluffy_Pillow 48848.7/63371: 77% mana bloodlust, rune_of_power
0:32.223 aoe n arcane_explosion Fluffy_Pillow 45122.4/63371: 71% mana bloodlust, arcane_charge, clearcasting, rune_of_power
0:33.229 aoe n arcane_explosion Fluffy_Pillow 46397.5/63371: 73% mana bloodlust, arcane_charge(2)
0:34.235 aoe n arcane_explosion Fluffy_Pillow 42672.5/63371: 67% mana bloodlust, arcane_charge(3)
0:35.241 aoe o arcane_barrage Fluffy_Pillow 38947.5/63371: 61% mana bloodlust, arcane_charge(4), clearcasting
0:36.248 aoe n arcane_explosion Fluffy_Pillow 42758.7/63371: 67% mana bloodlust, clearcasting
0:37.256 aoe n arcane_explosion Fluffy_Pillow 44036.3/63371: 69% mana bloodlust, arcane_charge
0:38.263 aoe n arcane_explosion Fluffy_Pillow 40312.6/63371: 64% mana bloodlust, arcane_charge(2)
0:39.269 aoe n arcane_explosion Fluffy_Pillow 36587.6/63371: 58% mana bloodlust, arcane_charge(3)
0:40.274 aoe o arcane_barrage Fluffy_Pillow 32861.4/63371: 52% mana bloodlust, arcane_charge(4)
0:41.281 aoe n arcane_explosion Fluffy_Pillow 36672.5/63371: 58% mana
0:42.587 aoe n arcane_explosion Fluffy_Pillow 33327.8/63371: 53% mana arcane_charge
0:43.894 aoe n arcane_explosion Fluffy_Pillow 29984.3/63371: 47% mana arcane_charge(2)
0:45.201 aoe n arcane_explosion Fluffy_Pillow 26640.8/63371: 42% mana arcane_charge(3), clearcasting
0:46.507 aoe o arcane_barrage Fluffy_Pillow 28296.1/63371: 45% mana arcane_charge(4)
0:47.815 aoe m arcane_orb Fluffy_Pillow 32488.8/63371: 51% mana
0:49.120 aoe o arcane_barrage Fluffy_Pillow 33642.8/63371: 53% mana arcane_charge(4)
0:50.425 aoe n arcane_explosion Fluffy_Pillow 37831.6/63371: 60% mana
0:51.733 aoe n arcane_explosion Fluffy_Pillow 34489.4/63371: 54% mana arcane_charge
0:53.038 aoe n arcane_explosion Fluffy_Pillow 31143.4/63371: 49% mana arcane_charge(2)
0:54.344 aoe n arcane_explosion Fluffy_Pillow 27798.7/63371: 44% mana arcane_charge(3)
0:55.651 aoe o arcane_barrage Fluffy_Pillow 24455.2/63371: 39% mana arcane_charge(4)
0:56.956 aoe n arcane_explosion Fluffy_Pillow 28644.0/63371: 45% mana
0:58.261 aoe n arcane_explosion Fluffy_Pillow 25298.0/63371: 40% mana arcane_charge
0:59.568 aoe n arcane_explosion Fluffy_Pillow 21954.6/63371: 35% mana arcane_charge(2)
1:00.872 aoe n arcane_explosion Fluffy_Pillow 18607.3/63371: 29% mana arcane_charge(3)
1:02.180 aoe o arcane_barrage Fluffy_Pillow 15265.1/63371: 24% mana arcane_charge(4)
1:03.486 aoe j touch_of_the_magi Fluffy_Pillow 19455.2/63371: 31% mana
1:04.792 aoe l rune_of_power Fluffy_Pillow 18610.5/63371: 29% mana arcane_charge(4)
1:06.099 aoe o arcane_barrage Fluffy_Pillow 20267.0/63371: 32% mana arcane_charge(4), rune_of_power
1:07.407 aoe n arcane_explosion Fluffy_Pillow 24459.7/63371: 39% mana rune_of_power
1:08.713 aoe n arcane_explosion Fluffy_Pillow 21114.9/63371: 33% mana arcane_charge, clearcasting, rune_of_power
1:10.019 aoe n arcane_explosion Fluffy_Pillow 22770.2/63371: 36% mana arcane_charge(2), rune_of_power
1:11.327 aoe n arcane_explosion Fluffy_Pillow 19428.0/63371: 31% mana arcane_charge(3), rune_of_power
1:12.632 aoe o arcane_barrage Fluffy_Pillow 16082.0/63371: 25% mana arcane_charge(4), clearcasting, rune_of_power
1:13.938 aoe m arcane_orb Fluffy_Pillow 20272.1/63371: 32% mana clearcasting, rune_of_power
1:15.245 aoe o arcane_barrage Fluffy_Pillow 21428.6/63371: 34% mana arcane_charge(4), clearcasting, rune_of_power
1:16.551 aoe n arcane_explosion Fluffy_Pillow 25618.7/63371: 40% mana clearcasting, rune_of_power
1:17.857 aoe n arcane_explosion Fluffy_Pillow 27274.0/63371: 43% mana arcane_charge, rune_of_power
1:19.166 aoe n arcane_explosion Fluffy_Pillow 23933.1/63371: 38% mana arcane_charge(2), rune_of_power
1:20.471 aoe n arcane_explosion Fluffy_Pillow 20587.1/63371: 32% mana arcane_charge(3), rune_of_power
1:21.777 aoe o arcane_barrage Fluffy_Pillow 17242.3/63371: 27% mana arcane_charge(4)
1:23.083 aoe n arcane_explosion Fluffy_Pillow 21432.4/63371: 34% mana
1:24.388 aoe n arcane_explosion Fluffy_Pillow 18086.4/63371: 29% mana arcane_charge
1:25.695 aoe n arcane_explosion Fluffy_Pillow 14743.0/63371: 23% mana arcane_charge(2)
1:27.001 aoe n arcane_explosion Fluffy_Pillow 11398.2/63371: 18% mana arcane_charge(3)
1:28.307 aoe o arcane_barrage Fluffy_Pillow 8053.5/63371: 13% mana arcane_charge(4)
1:29.614 aoe n arcane_explosion Fluffy_Pillow 12244.9/63371: 19% mana
1:30.919 aoe n arcane_explosion Fluffy_Pillow 8898.9/63371: 14% mana arcane_charge
1:32.226 aoe n arcane_explosion Fluffy_Pillow 5555.4/63371: 9% mana arcane_charge(2), clearcasting
1:33.534 aoe n arcane_explosion Fluffy_Pillow 7213.2/63371: 11% mana arcane_charge(3)
1:34.840 aoe o arcane_barrage Fluffy_Pillow 3868.4/63371: 6% mana arcane_charge(4)
1:36.147 aoe m arcane_orb Fluffy_Pillow 8059.8/63371: 13% mana
1:37.453 aoe o arcane_barrage Fluffy_Pillow 9215.1/63371: 15% mana arcane_charge(4)
1:38.761 aoe n arcane_explosion Fluffy_Pillow 13407.7/63371: 21% mana
1:40.067 aoe n arcane_explosion Fluffy_Pillow 10063.0/63371: 16% mana arcane_charge, clearcasting
1:41.372 aoe n arcane_explosion Fluffy_Pillow 11717.0/63371: 18% mana arcane_charge(2)
1:42.677 aoe n arcane_explosion Fluffy_Pillow 8371.0/63371: 13% mana arcane_charge(3)
1:43.984 aoe o arcane_barrage Fluffy_Pillow 5027.5/63371: 8% mana arcane_charge(4)
1:45.291 aoe n arcane_explosion Fluffy_Pillow 9218.9/63371: 15% mana
1:46.596 aoe n arcane_explosion Fluffy_Pillow 5872.9/63371: 9% mana arcane_charge
1:47.901 aoe p evocation arcane 2526.9/63371: 4% mana arcane_charge(2)
1:52.246 aoe j touch_of_the_magi Fluffy_Pillow 56372.8/63371: 89% mana arcane_charge(2)
1:53.553 aoe l rune_of_power Fluffy_Pillow 55529.4/63371: 88% mana arcane_charge(4)
1:54.861 aoe o arcane_barrage Fluffy_Pillow 57187.2/63371: 90% mana arcane_charge(4), rune_of_power
1:56.167 aoe m arcane_orb Fluffy_Pillow 61377.3/63371: 97% mana rune_of_power
1:57.473 aoe o arcane_barrage Fluffy_Pillow 62532.5/63371: 99% mana arcane_charge(4), rune_of_power
1:58.781 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:00.088 aoe n arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, rune_of_power
2:01.393 aoe n arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), clearcasting, rune_of_power
2:02.699 aoe n arcane_explosion Fluffy_Pillow 58337.2/63371: 92% mana arcane_charge(3), rune_of_power
2:04.005 aoe o arcane_barrage Fluffy_Pillow 54992.5/63371: 87% mana arcane_charge(4), rune_of_power
2:05.311 aoe n arcane_explosion Fluffy_Pillow 59182.6/63371: 93% mana rune_of_power
2:06.617 aoe n arcane_explosion Fluffy_Pillow 55837.9/63371: 88% mana arcane_charge, rune_of_power
2:07.924 aoe n arcane_explosion Fluffy_Pillow 52494.4/63371: 83% mana arcane_charge(2), clearcasting, rune_of_power
2:09.229 aoe n arcane_explosion Fluffy_Pillow 54148.4/63371: 85% mana arcane_charge(3), rune_of_power
2:10.534 aoe k arcane_power Fluffy_Pillow 50802.4/63371: 80% mana arcane_charge(4)
2:10.534 aoe o arcane_barrage Fluffy_Pillow 50802.4/63371: 80% mana arcane_charge(4), arcane_power, rune_of_power
2:11.841 aoe n arcane_explosion Fluffy_Pillow 54993.8/63371: 87% mana arcane_power, rune_of_power
2:13.146 aoe n arcane_explosion Fluffy_Pillow 54147.8/63371: 85% mana arcane_charge, arcane_power, clearcasting, rune_of_power
2:14.453 aoe n arcane_explosion Fluffy_Pillow 55804.3/63371: 88% mana arcane_charge(2), arcane_power, rune_of_power
2:15.759 aoe n arcane_explosion Fluffy_Pillow 54959.5/63371: 87% mana arcane_charge(3), arcane_power, rune_of_power
2:17.064 aoe o arcane_barrage Fluffy_Pillow 54113.5/63371: 85% mana arcane_charge(4), arcane_power, rune_of_power
2:18.369 aoe m arcane_orb Fluffy_Pillow 58302.4/63371: 92% mana arcane_power, rune_of_power
2:19.675 aoe o arcane_barrage Fluffy_Pillow 59707.7/63371: 94% mana arcane_charge(4), arcane_power, rune_of_power
2:20.983 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, rune_of_power
2:22.289 aoe n arcane_explosion Fluffy_Pillow 62526.7/63371: 99% mana arcane_charge, arcane_power, rune_of_power
2:23.595 aoe n arcane_explosion Fluffy_Pillow 61682.0/63371: 97% mana arcane_charge(2), arcane_power, rune_of_power
2:24.902 aoe n arcane_explosion Fluffy_Pillow 60838.5/63371: 96% mana arcane_charge(3), arcane_power, rune_of_power
2:26.208 aoe o arcane_barrage Fluffy_Pillow 59993.7/63371: 95% mana arcane_charge(4)
2:27.514 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
2:28.821 aoe n arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge
2:30.128 aoe n arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), clearcasting
2:31.435 aoe n arcane_explosion Fluffy_Pillow 58341.0/63371: 92% mana arcane_charge(3)
2:32.742 aoe o arcane_barrage Fluffy_Pillow 54997.5/63371: 87% mana arcane_charge(4)
2:34.050 aoe n arcane_explosion Fluffy_Pillow 59190.2/63371: 93% mana
2:35.355 aoe n arcane_explosion Fluffy_Pillow 55844.2/63371: 88% mana arcane_charge
2:36.664 shared_cds q use_mana_gem arcane 52503.3/63371: 83% mana arcane_charge(2)
2:36.664 aoe n arcane_explosion Fluffy_Pillow 58840.4/63371: 93% mana arcane_charge(2)
2:37.970 aoe n arcane_explosion Fluffy_Pillow 55495.7/63371: 88% mana arcane_charge(3)
2:39.277 aoe o arcane_barrage Fluffy_Pillow 52152.2/63371: 82% mana arcane_charge(4)
2:40.583 aoe j touch_of_the_magi Fluffy_Pillow 56342.3/63371: 89% mana
2:41.890 aoe l rune_of_power Fluffy_Pillow 55498.8/63371: 88% mana arcane_charge(4)
2:43.198 aoe o arcane_barrage Fluffy_Pillow 57156.6/63371: 90% mana arcane_charge(4), rune_of_power
2:44.505 aoe m arcane_orb Fluffy_Pillow 61348.0/63371: 97% mana rune_of_power
2:45.813 aoe o arcane_barrage Fluffy_Pillow 62505.8/63371: 99% mana arcane_charge(4), rune_of_power
2:47.120 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:48.427 aoe n arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, clearcasting, rune_of_power
2:49.733 aoe n arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2), rune_of_power
2:51.039 aoe n arcane_explosion Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(3), rune_of_power
2:52.346 aoe o arcane_barrage Fluffy_Pillow 54995.0/63371: 87% mana arcane_charge(4), rune_of_power
2:53.652 aoe n arcane_explosion Fluffy_Pillow 59185.1/63371: 93% mana rune_of_power
2:54.959 aoe n arcane_explosion Fluffy_Pillow 55841.7/63371: 88% mana arcane_charge, rune_of_power
2:56.266 aoe n arcane_explosion Fluffy_Pillow 52498.2/63371: 83% mana arcane_charge(2), rune_of_power
2:57.572 aoe n arcane_explosion Fluffy_Pillow 49153.4/63371: 78% mana arcane_charge(3), rune_of_power
2:58.877 aoe o arcane_barrage Fluffy_Pillow 45807.4/63371: 72% mana arcane_charge(4)
3:00.184 aoe n arcane_explosion Fluffy_Pillow 49998.8/63371: 79% mana
3:01.490 aoe n arcane_explosion Fluffy_Pillow 46654.1/63371: 74% mana arcane_charge
3:02.798 aoe n arcane_explosion Fluffy_Pillow 43311.9/63371: 68% mana arcane_charge(2)
3:04.105 aoe n arcane_explosion Fluffy_Pillow 39968.4/63371: 63% mana arcane_charge(3), clearcasting
3:05.410 aoe o arcane_barrage Fluffy_Pillow 41622.4/63371: 66% mana arcane_charge(4)
3:06.718 aoe m arcane_orb Fluffy_Pillow 45815.1/63371: 72% mana
3:08.025 aoe o arcane_barrage Fluffy_Pillow 46971.6/63371: 74% mana arcane_charge(4)
3:09.332 aoe n arcane_explosion Fluffy_Pillow 51163.0/63371: 81% mana
3:10.641 aoe n arcane_explosion Fluffy_Pillow 47822.0/63371: 75% mana arcane_charge
3:11.947 aoe n arcane_explosion Fluffy_Pillow 44477.3/63371: 70% mana arcane_charge(2)
3:13.254 aoe n arcane_explosion Fluffy_Pillow 41133.8/63371: 65% mana arcane_charge(3), clearcasting
3:14.559 aoe o arcane_barrage Fluffy_Pillow 42787.8/63371: 68% mana arcane_charge(4)
3:15.864 aoe n arcane_explosion Fluffy_Pillow 46976.7/63371: 74% mana
3:17.172 aoe n arcane_explosion Fluffy_Pillow 43634.5/63371: 69% mana arcane_charge
3:18.479 aoe n arcane_explosion Fluffy_Pillow 40291.0/63371: 64% mana arcane_charge(2)
3:19.785 aoe n arcane_explosion Fluffy_Pillow 36946.3/63371: 58% mana arcane_charge(3)
3:21.093 aoe o arcane_barrage Fluffy_Pillow 33604.1/63371: 53% mana arcane_charge(4)
3:22.399 aoe n arcane_explosion Fluffy_Pillow 37794.2/63371: 60% mana
3:23.707 aoe n arcane_explosion Fluffy_Pillow 34452.0/63371: 54% mana arcane_charge
3:25.014 aoe n arcane_explosion Fluffy_Pillow 31108.5/63371: 49% mana arcane_charge(2)
3:26.321 aoe n arcane_explosion Fluffy_Pillow 27765.0/63371: 44% mana arcane_charge(3)
3:27.629 aoe o arcane_barrage Fluffy_Pillow 24422.8/63371: 39% mana arcane_charge(4)
3:28.936 aoe j touch_of_the_magi Fluffy_Pillow 28614.2/63371: 45% mana
3:30.241 aoe l rune_of_power Fluffy_Pillow 27768.2/63371: 44% mana arcane_charge(4), clearcasting
3:31.547 aoe o arcane_barrage Fluffy_Pillow 29423.5/63371: 46% mana arcane_charge(4), clearcasting, rune_of_power
3:32.852 aoe m arcane_orb Fluffy_Pillow 33612.3/63371: 53% mana clearcasting, rune_of_power
3:34.160 aoe o arcane_barrage Fluffy_Pillow 34770.1/63371: 55% mana arcane_charge(4), clearcasting, rune_of_power
3:35.468 aoe n arcane_explosion Fluffy_Pillow 38962.8/63371: 61% mana clearcasting, rune_of_power
3:36.774 aoe n arcane_explosion Fluffy_Pillow 40618.0/63371: 64% mana arcane_charge, rune_of_power
3:38.080 aoe n arcane_explosion Fluffy_Pillow 37273.3/63371: 59% mana arcane_charge(2), rune_of_power
3:39.386 aoe n arcane_explosion Fluffy_Pillow 33928.6/63371: 54% mana arcane_charge(3), rune_of_power
3:40.693 aoe o arcane_barrage Fluffy_Pillow 30585.1/63371: 48% mana arcane_charge(4), rune_of_power
3:41.999 aoe n arcane_explosion Fluffy_Pillow 34775.2/63371: 55% mana rune_of_power
3:43.306 aoe n arcane_explosion Fluffy_Pillow 31431.7/63371: 50% mana arcane_charge, rune_of_power
3:44.614 aoe n arcane_explosion Fluffy_Pillow 28089.5/63371: 44% mana arcane_charge(2), rune_of_power
3:45.920 aoe n arcane_explosion Fluffy_Pillow 24744.8/63371: 39% mana arcane_charge(3), rune_of_power
3:47.227 aoe o arcane_barrage Fluffy_Pillow 21401.3/63371: 34% mana arcane_charge(4)
3:48.534 aoe n arcane_explosion Fluffy_Pillow 25592.7/63371: 40% mana
3:49.839 aoe n arcane_explosion Fluffy_Pillow 22246.7/63371: 35% mana arcane_charge
3:51.145 aoe n arcane_explosion Fluffy_Pillow 18902.0/63371: 30% mana arcane_charge(2), clearcasting
3:52.451 aoe n arcane_explosion Fluffy_Pillow 20557.2/63371: 32% mana arcane_charge(3)
3:53.756 aoe o arcane_barrage Fluffy_Pillow 17211.2/63371: 27% mana arcane_charge(4), clearcasting
3:55.064 aoe m arcane_orb Fluffy_Pillow 21403.9/63371: 34% mana clearcasting
3:56.370 aoe o arcane_barrage Fluffy_Pillow 22559.1/63371: 36% mana arcane_charge(4), clearcasting
3:57.676 aoe n arcane_explosion Fluffy_Pillow 26749.3/63371: 42% mana clearcasting
3:58.981 aoe n arcane_explosion Fluffy_Pillow 28403.3/63371: 45% mana arcane_charge
4:00.287 aoe n arcane_explosion Fluffy_Pillow 25058.5/63371: 40% mana arcane_charge(2)
4:01.594 aoe n arcane_explosion Fluffy_Pillow 21715.0/63371: 34% mana arcane_charge(3), clearcasting
4:02.901 aoe o arcane_barrage Fluffy_Pillow 23371.6/63371: 37% mana arcane_charge(4)
4:04.206 aoe n arcane_explosion Fluffy_Pillow 27560.4/63371: 43% mana
4:05.512 aoe n arcane_explosion Fluffy_Pillow 24215.7/63371: 38% mana arcane_charge
4:06.818 aoe n arcane_explosion Fluffy_Pillow 20871.0/63371: 33% mana arcane_charge(2), clearcasting
4:08.125 aoe n arcane_explosion Fluffy_Pillow 22527.5/63371: 36% mana arcane_charge(3)
4:09.431 aoe o arcane_barrage Fluffy_Pillow 19182.7/63371: 30% mana arcane_charge(4)
4:10.739 aoe n arcane_explosion Fluffy_Pillow 23375.4/63371: 37% mana
4:12.046 aoe n arcane_explosion Fluffy_Pillow 20031.9/63371: 32% mana arcane_charge
4:13.350 aoe n arcane_explosion Fluffy_Pillow 16684.7/63371: 26% mana arcane_charge(2), clearcasting
4:14.657 aoe n arcane_explosion Fluffy_Pillow 18341.2/63371: 29% mana arcane_charge(3)
4:15.963 aoe o arcane_barrage Fluffy_Pillow 14996.4/63371: 24% mana arcane_charge(4)
4:17.268 aoe j touch_of_the_magi Fluffy_Pillow 19185.3/63371: 30% mana
4:18.575 aoe k arcane_power Fluffy_Pillow 18341.8/63371: 29% mana arcane_charge(4)
4:18.575 shared_cds s berserking Fluffy_Pillow 18341.8/63371: 29% mana arcane_charge(4), arcane_power, rune_of_power
4:18.575 aoe o arcane_barrage Fluffy_Pillow 18341.8/63371: 29% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:19.763 aoe m arcane_orb Fluffy_Pillow 22382.4/63371: 35% mana berserking, arcane_power, rune_of_power
4:20.954 aoe o arcane_barrage Fluffy_Pillow 23641.9/63371: 37% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:22.143 aoe n arcane_explosion Fluffy_Pillow 27683.7/63371: 44% mana berserking, arcane_power, rune_of_power
4:23.332 aoe n arcane_explosion Fluffy_Pillow 26690.7/63371: 42% mana berserking, arcane_charge, arcane_power, rune_of_power
4:24.519 aoe n arcane_explosion Fluffy_Pillow 25695.1/63371: 41% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:25.709 aoe n arcane_explosion Fluffy_Pillow 24703.4/63371: 39% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:26.897 aoe o arcane_barrage Fluffy_Pillow 23709.1/63371: 37% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:28.086 aoe n arcane_explosion Fluffy_Pillow 27750.9/63371: 44% mana berserking, arcane_power, rune_of_power
4:29.276 aoe n arcane_explosion Fluffy_Pillow 26759.1/63371: 42% mana berserking, arcane_charge, arcane_power, rune_of_power
4:30.464 aoe n arcane_explosion Fluffy_Pillow 25764.9/63371: 41% mana berserking, arcane_charge(2), arcane_power, rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Simulation & Raid Information

Iterations: 1034
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 298.9 )

Performance:

Total Events Processed: 19758653
Max Event Queue: 295
Sim Seconds: 309074
CPU Seconds: 44.0938
Physical Seconds: 7.3568
Speed Up: 7009

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Forgelite Kyrian_Forgelite arcane_barrage 44425 1704415 5702 55.29 5178 10419 55.2 275.4 19.3% 0.0% 0.0% 0.0% 5.42sec 1704415 298.91sec
Kyrian_Forgelite Kyrian_Forgelite arcane_echo 342232 185441 620 59.13 528 1055 58.9 294.6 19.3% 0.0% 0.0% 0.0% 4.75sec 185441 298.91sec
Kyrian_Forgelite Kyrian_Forgelite arcane_explosion 1449 2287167 7652 148.80 2588 5171 148.3 741.3 19.3% 0.0% 0.0% 0.0% 1.98sec 2287167 298.91sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.15sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb_bolt 153640 417204 1396 12.75 5502 11026 63.5 63.5 19.3% 0.0% 0.0% 0.0% 24.15sec 417204 298.91sec
Kyrian_Forgelite Kyrian_Forgelite arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 131.19sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 262.11sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.76sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite deathly_eruption 322256 20339 68 2.95 1164 2327 14.7 14.7 19.0% 0.0% 0.0% 0.0% 1.76sec 20339 298.91sec
Kyrian_Forgelite Kyrian_Forgelite evocation 12051 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 157.37sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite frostbolt 116 1774 6 0.20 1481 2961 0.0 1.0 19.8% 0.0% 0.0% 0.0% 0.00sec 1774 298.91sec
Kyrian_Forgelite Kyrian_Forgelite mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite_mirror_image frostbolt 59638 6111 153 135.00 57 114 90.0 90.0 19.5% 0.0% 0.0% 0.0% 1.29sec 6111 40.00sec
Kyrian_Forgelite Kyrian_Forgelite potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark 307443 33610 112 1.85 3034 6159 9.2 9.2 19.6% 0.0% 0.0% 0.0% 34.07sec 56474 298.91sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark ticks -307443 22864 76 12.00 320 638 9.2 60.0 19.3% 0.0% 0.0% 0.0% 34.07sec 56474 298.91sec
Kyrian_Forgelite Kyrian_Forgelite rune_of_power 116011 0 0 0.00 0 0 5.7 0.0 0.0% 0.0% 0.0% 0.0% 52.86sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.81sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi_explosion 210833 352135 1178 5.91 11970 0 5.9 29.4 0.0% 0.0% 0.0% 0.0% 54.67sec 352135 298.91sec
Kyrian_Forgelite Kyrian_Forgelite use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.70sec 0 298.91sec
Kyrian_Forgelite Kyrian_Forgelite_bron anima_cannon 332525 0 0 0.00 0 0 7.6 0.0 0.0% 0.0% 0.0% 0.0% 22.39sec 0 56.98sec
Kyrian_Forgelite Kyrian_Forgelite_bron goliath_support 332526 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 12.06sec 0 56.98sec
Kyrian_Forgelite Kyrian_Forgelite_bron melee 0 4267 75 18.33 205 411 17.4 17.4 19.4% 0.0% 0.0% 0.0% 9.02sec 6094 56.98sec
Kyrian_Forgelite Kyrian_Forgelite_bron smash 341163 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 22.43sec 0 56.98sec
Kyrian_Pelagos Kyrian_Pelagos arcane_barrage 44425 1717755 5747 55.33 5226 10476 55.2 275.6 19.2% 0.0% 0.0% 0.0% 5.42sec 1717755 298.91sec
Kyrian_Pelagos Kyrian_Pelagos arcane_echo 342232 186284 623 59.43 528 1056 59.2 296.1 19.3% 0.0% 0.0% 0.0% 4.72sec 186284 298.91sec
Kyrian_Pelagos Kyrian_Pelagos arcane_explosion 1449 2320638 7764 148.90 2620 5249 148.4 741.8 19.4% 0.0% 0.0% 0.0% 1.98sec 2320638 298.91sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.16sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb_bolt 153640 426583 1427 12.76 5630 11269 63.6 63.6 19.2% 0.0% 0.0% 0.0% 24.15sec 426583 298.91sec
Kyrian_Pelagos Kyrian_Pelagos arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 131.84sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 263.13sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.74sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos deathly_eruption 322256 20396 68 2.95 1164 2327 14.7 14.7 19.4% 0.0% 0.0% 0.0% 1.74sec 20396 298.91sec
Kyrian_Pelagos Kyrian_Pelagos evocation 12051 0 0 0.00 0 0 0.9 0.0 0.0% 0.0% 0.0% 0.0% 170.58sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos frostbolt 116 1786 6 0.20 1481 2961 0.0 1.0 20.6% 0.0% 0.0% 0.0% 0.00sec 1786 298.91sec
Kyrian_Pelagos Kyrian_Pelagos mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos_mirror_image frostbolt 59638 6091 152 135.00 57 114 90.0 90.0 19.1% 0.0% 0.0% 0.0% 1.29sec 6091 40.00sec
Kyrian_Pelagos Kyrian_Pelagos potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark 307443 33424 112 1.86 3020 6091 9.3 9.3 19.0% 0.0% 0.0% 0.0% 33.91sec 56445 298.91sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark ticks -307443 23021 77 12.06 320 643 9.3 60.3 19.2% 0.0% 0.0% 0.0% 33.91sec 56445 298.91sec
Kyrian_Pelagos Kyrian_Pelagos rune_of_power 116011 0 0 0.00 0 0 5.7 0.0 0.0% 0.0% 0.0% 0.0% 52.78sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.65sec 0 298.91sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi_explosion 210833 363187 1215 5.92 12325 0 5.9 29.5 0.0% 0.0% 0.0% 0.0% 54.52sec 363187 298.91sec
Kyrian_Pelagos Kyrian_Pelagos use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.34sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni arcane_barrage 44425 1845365 6174 56.70 5483 10920 56.6 282.5 19.4% 0.0% 0.0% 0.0% 5.28sec 1845365 298.91sec
Necrolord_Emeni Necrolord_Emeni arcane_blast 30451 2 0 0.00 2296 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 2 298.91sec
Necrolord_Emeni Necrolord_Emeni arcane_echo 342232 129000 432 36.14 600 1201 36.0 180.1 19.4% 0.0% 0.0% 0.0% 7.80sec 129000 298.91sec
Necrolord_Emeni Necrolord_Emeni arcane_explosion 1449 2499621 8362 153.80 2738 5464 153.2 766.2 19.3% 0.0% 0.0% 0.0% 1.92sec 2499621 298.91sec
Necrolord_Emeni Necrolord_Emeni arcane_orb 153626 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.81sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni arcane_orb_bolt 153640 448455 1500 12.96 5790 11707 64.6 64.6 19.5% 0.0% 0.0% 0.0% 23.81sec 448455 298.91sec
Necrolord_Emeni Necrolord_Emeni arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.50sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.00sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni deathborne 324220 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.19sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni deathly_fixation 322253 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 1.82sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni deathly_eruption 322256 20188 68 2.92 1164 2327 14.5 14.5 19.4% 0.0% 0.0% 0.0% 1.82sec 20188 298.91sec
Necrolord_Emeni Necrolord_Emeni evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 172.37sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni frostbolt 116 1756 6 0.20 1481 2961 0.0 1.0 18.6% 0.0% 0.0% 0.0% 0.00sec 1756 298.91sec
Necrolord_Emeni Necrolord_Emeni mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni_mirror_image frostbolt 59638 6857 171 135.00 64 128 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6857 40.00sec
Necrolord_Emeni Necrolord_Emeni potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni presence_of_mind 205025 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 51.47sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi 321507 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 53.09sec 0 298.91sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi_explosion 210833 304838 1020 6.03 10151 0 6.0 30.1 0.0% 0.0% 0.0% 0.0% 52.98sec 304838 298.91sec
Necrolord_Emeni Necrolord_Emeni use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.08sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth arcane_barrage 44425 1765654 5907 56.70 5226 10523 56.6 282.5 19.4% 0.0% 0.0% 0.0% 5.28sec 1765654 298.91sec
Necrolord_Marileth Necrolord_Marileth arcane_echo 342232 119911 401 36.08 559 1118 36.0 179.8 19.4% 0.0% 0.0% 0.0% 7.82sec 119911 298.91sec
Necrolord_Marileth Necrolord_Marileth arcane_explosion 1449 2399087 8026 153.92 2624 5243 153.4 766.8 19.3% 0.0% 0.0% 0.0% 1.92sec 2399087 298.91sec
Necrolord_Marileth Necrolord_Marileth arcane_orb 153626 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.82sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth arcane_orb_bolt 153640 426881 1428 12.94 5549 11118 64.5 64.5 19.3% 0.0% 0.0% 0.0% 23.82sec 426881 298.91sec
Necrolord_Marileth Necrolord_Marileth arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.82sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.59sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth deathborne 324220 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.61sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.76sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth deathly_eruption 322256 20380 68 2.96 1164 2327 14.7 14.7 18.8% 0.0% 0.0% 0.0% 1.76sec 20380 298.91sec
Necrolord_Marileth Necrolord_Marileth evocation 12051 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 162.24sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth frostbolt 116 1761 6 0.20 1481 2961 0.0 1.0 19.0% 0.0% 0.0% 0.0% 0.00sec 1761 298.91sec
Necrolord_Marileth Necrolord_Marileth mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth_mirror_image frostbolt 59638 6101 153 135.00 57 114 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6101 40.00sec
Necrolord_Marileth Necrolord_Marileth potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth presence_of_mind 205025 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 51.38sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi 321507 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 52.95sec 0 298.91sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi_explosion 210833 282439 945 6.04 9386 0 6.0 30.1 0.0% 0.0% 0.0% 0.0% 52.82sec 282439 298.91sec
Necrolord_Marileth Necrolord_Marileth use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.10sec 0 298.91sec
NightFae_Dream NightFae_Dream arcane_barrage 44425 1741203 5825 54.15 5412 10808 54.0 269.8 19.4% 0.0% 0.0% 0.0% 5.55sec 1741203 298.91sec
NightFae_Dream NightFae_Dream arcane_echo 342232 144000 482 41.36 586 1174 41.2 206.1 19.3% 0.0% 0.0% 0.0% 6.91sec 144000 298.91sec
NightFae_Dream NightFae_Dream arcane_explosion 1449 2318168 7755 142.53 2735 5475 142.0 710.1 19.3% 0.0% 0.0% 0.0% 2.08sec 2318168 298.91sec
NightFae_Dream NightFae_Dream arcane_orb 153626 0 0 0.00 0 0 13.8 0.0 0.0% 0.0% 0.0% 0.0% 22.28sec 0 298.91sec
NightFae_Dream NightFae_Dream arcane_orb_bolt 153640 439619 1471 13.84 5337 10715 68.9 68.9 19.3% 0.0% 0.0% 0.0% 22.28sec 439619 298.91sec
NightFae_Dream NightFae_Dream arcane_power 12042 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 97.24sec 0 298.91sec
NightFae_Dream NightFae_Dream berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.66sec 0 298.91sec
NightFae_Dream NightFae_Dream conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream NightFae_Dream deathly_fixation 322253 0 0 0.00 0 0 18.4 0.0 0.0% 0.0% 0.0% 0.0% 8.80sec 0 298.91sec
NightFae_Dream NightFae_Dream deathly_eruption 322256 25547 85 3.68 1164 2327 18.4 18.4 19.6% 0.0% 0.0% 0.0% 8.80sec 25547 298.91sec
NightFae_Dream NightFae_Dream evocation 12051 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream NightFae_Dream flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream NightFae_Dream food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream NightFae_Dream frostbolt 116 1748 6 0.20 1481 2961 0.0 1.0 18.1% 0.0% 0.0% 0.0% 0.00sec 1748 298.91sec
NightFae_Dream NightFae_Dream mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream NightFae_Dream_mirror_image frostbolt 59638 6045 151 135.00 56 113 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 6045 40.00sec
NightFae_Dream NightFae_Dream potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.51sec 0 298.91sec
NightFae_Dream NightFae_Dream rune_of_power 116011 0 0 0.00 0 0 6.3 0.0 0.0% 0.0% 0.0% 0.0% 47.95sec 0 298.91sec
NightFae_Dream NightFae_Dream shifting_power ticks -314791 192317 641 4.70 1372 2745 5.9 23.5 19.3% 0.0% 0.0% 0.0% 49.52sec 192317 298.91sec
NightFae_Dream NightFae_Dream touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.18sec 0 298.91sec
NightFae_Dream NightFae_Dream touch_of_the_magi_explosion 210833 323529 1082 6.54 9935 0 6.6 32.6 0.0% 0.0% 0.0% 0.0% 49.02sec 323529 298.91sec
NightFae_Dream NightFae_Dream use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.80sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB arcane_barrage 44425 1762753 5897 54.17 5487 10920 54.1 269.8 19.3% 0.0% 0.0% 0.0% 5.55sec 1762753 298.91sec
NightFae_Dream_SB NightFae_Dream_SB arcane_echo 342232 145809 488 41.37 593 1184 41.2 206.1 19.3% 0.0% 0.0% 0.0% 6.89sec 145809 298.91sec
NightFae_Dream_SB NightFae_Dream_SB arcane_explosion 1449 2348728 7858 142.59 2771 5540 142.1 710.4 19.3% 0.0% 0.0% 0.0% 2.08sec 2348728 298.91sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb 153626 0 0 0.00 0 0 13.8 0.0 0.0% 0.0% 0.0% 0.0% 22.28sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb_bolt 153640 444252 1486 13.84 5410 10865 68.9 68.9 19.0% 0.0% 0.0% 0.0% 22.28sec 444252 298.91sec
NightFae_Dream_SB NightFae_Dream_SB arcane_power 12042 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 97.20sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.66sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB deathly_fixation 322253 0 0 0.00 0 0 18.5 0.0 0.0% 0.0% 0.0% 0.0% 8.79sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB deathly_eruption 322256 26159 88 3.71 1181 2364 18.5 18.5 19.9% 0.0% 0.0% 0.0% 8.79sec 26159 298.91sec
NightFae_Dream_SB NightFae_Dream_SB evocation 12051 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB frostbolt 116 1805 6 0.20 1520 3040 0.0 1.0 18.8% 0.0% 0.0% 0.0% 0.00sec 1805 298.91sec
NightFae_Dream_SB NightFae_Dream_SB mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB_mirror_image frostbolt 59638 6124 153 135.00 57 114 90.0 90.0 19.5% 0.0% 0.0% 0.0% 1.29sec 6124 40.00sec
NightFae_Dream_SB NightFae_Dream_SB potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.48sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB rune_of_power 116011 0 0 0.00 0 0 6.3 0.0 0.0% 0.0% 0.0% 0.0% 47.98sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB shifting_power ticks -314791 195663 652 4.70 1394 2788 5.9 23.5 19.4% 0.0% 0.0% 0.0% 49.55sec 195663 298.91sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.17sec 0 298.91sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi_explosion 210833 327520 1096 6.54 10072 0 6.6 32.6 0.0% 0.0% 0.0% 0.0% 49.01sec 327520 298.91sec
NightFae_Dream_SB NightFae_Dream_SB use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.70sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon arcane_barrage 44425 1778557 5950 54.17 5520 11081 54.1 269.9 19.3% 0.0% 0.0% 0.0% 5.55sec 1778557 298.91sec
NightFae_Koraylon NightFae_Koraylon arcane_echo 342232 148874 498 41.35 606 1210 41.2 206.0 19.3% 0.0% 0.0% 0.0% 6.91sec 148874 298.91sec
NightFae_Koraylon NightFae_Koraylon arcane_explosion 1449 2387875 7989 142.52 2820 5637 142.0 710.0 19.3% 0.0% 0.0% 0.0% 2.08sec 2387875 298.91sec
NightFae_Koraylon NightFae_Koraylon arcane_orb 153626 0 0 0.00 0 0 13.8 0.0 0.0% 0.0% 0.0% 0.0% 22.33sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon arcane_orb_bolt 153640 453377 1517 13.84 5506 11012 69.0 69.0 19.4% 0.0% 0.0% 0.0% 22.33sec 453377 298.91sec
NightFae_Koraylon NightFae_Koraylon arcane_power 12042 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 97.23sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.67sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon deathly_fixation 322253 0 0 0.00 0 0 18.4 0.0 0.0% 0.0% 0.0% 0.0% 8.96sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon deathly_eruption 322256 27688 93 3.70 1255 2512 18.4 18.4 19.7% 0.0% 0.0% 0.0% 8.96sec 27688 298.91sec
NightFae_Koraylon NightFae_Koraylon evocation 12051 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon frostbolt 116 1922 6 0.20 1629 3257 0.0 1.0 18.0% 0.0% 0.0% 0.0% 0.00sec 1922 298.91sec
NightFae_Koraylon NightFae_Koraylon mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon_mirror_image frostbolt 59638 6043 151 135.00 56 112 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 6043 40.00sec
NightFae_Koraylon NightFae_Koraylon potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.48sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon rune_of_power 116011 0 0 0.00 0 0 6.3 0.0 0.0% 0.0% 0.0% 0.0% 47.93sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon shifting_power ticks -314791 196504 655 4.70 1402 2804 5.9 23.5 19.2% 0.0% 0.0% 0.0% 49.51sec 196504 298.91sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.21sec 0 298.91sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi_explosion 210833 334115 1118 6.54 10269 0 6.6 32.6 0.0% 0.0% 0.0% 0.0% 49.04sec 334115 298.91sec
NightFae_Koraylon NightFae_Koraylon use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.65sec 0 298.91sec
NightFae_Niya NightFae_Niya arcane_barrage 44425 1772780 5931 54.33 5494 10991 54.2 270.7 19.3% 0.0% 0.0% 0.0% 5.53sec 1772780 298.91sec
NightFae_Niya NightFae_Niya arcane_echo 342232 144036 482 41.38 586 1171 41.2 206.1 19.3% 0.0% 0.0% 0.0% 6.91sec 144036 298.91sec
NightFae_Niya NightFae_Niya arcane_explosion 1449 2378009 7956 142.98 2798 5592 142.5 712.3 19.3% 0.0% 0.0% 0.0% 2.07sec 2378009 298.91sec
NightFae_Niya NightFae_Niya arcane_orb 153626 0 0 0.00 0 0 13.9 0.0 0.0% 0.0% 0.0% 0.0% 22.19sec 0 298.91sec
NightFae_Niya NightFae_Niya arcane_orb_bolt 153640 451450 1510 13.92 5442 10900 69.3 69.3 19.6% 0.0% 0.0% 0.0% 22.19sec 451450 298.91sec
NightFae_Niya NightFae_Niya arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.16sec 0 298.91sec
NightFae_Niya NightFae_Niya berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.68sec 0 298.91sec
NightFae_Niya NightFae_Niya conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Niya NightFae_Niya deathly_fixation 322253 0 0 0.00 0 0 18.4 0.0 0.0% 0.0% 0.0% 0.0% 8.92sec 0 298.91sec
NightFae_Niya NightFae_Niya deathly_eruption 322256 25623 86 3.70 1164 2327 18.4 18.4 19.4% 0.0% 0.0% 0.0% 8.92sec 25623 298.91sec
NightFae_Niya NightFae_Niya evocation 12051 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Niya NightFae_Niya flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Niya NightFae_Niya food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Niya NightFae_Niya frostbolt 116 1780 6 0.20 1481 2961 0.0 1.0 20.2% 0.0% 0.0% 0.0% 0.00sec 1780 298.91sec
NightFae_Niya NightFae_Niya mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
NightFae_Niya NightFae_Niya_mirror_image frostbolt 59638 6048 151 135.00 56 112 90.0 90.0 19.5% 0.0% 0.0% 0.0% 1.29sec 6048 40.00sec
NightFae_Niya NightFae_Niya potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.36sec 0 298.91sec
NightFae_Niya NightFae_Niya rune_of_power 116011 0 0 0.00 0 0 6.3 0.0 0.0% 0.0% 0.0% 0.0% 47.94sec 0 298.91sec
NightFae_Niya NightFae_Niya shifting_power ticks -314791 192357 641 4.70 1372 2745 5.9 23.5 19.3% 0.0% 0.0% 0.0% 49.52sec 192357 298.91sec
NightFae_Niya NightFae_Niya touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.17sec 0 298.91sec
NightFae_Niya NightFae_Niya touch_of_the_magi_explosion 210833 331130 1108 6.54 10174 0 6.6 32.6 0.0% 0.0% 0.0% 0.0% 49.01sec 331130 298.91sec
NightFae_Niya NightFae_Niya use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.77sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia arcane_barrage 44425 1759250 5886 57.53 5135 10327 57.4 286.6 19.4% 0.0% 0.0% 0.0% 5.20sec 1759250 298.91sec
Venthyr_Nadjia Venthyr_Nadjia arcane_echo 342232 137632 460 43.36 534 1069 43.2 216.0 19.2% 0.0% 0.0% 0.0% 6.47sec 137632 298.91sec
Venthyr_Nadjia Venthyr_Nadjia arcane_explosion 1449 2383759 7975 156.65 2563 5124 156.1 780.4 19.2% 0.0% 0.0% 0.0% 1.89sec 2383759 298.91sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb 153626 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.40sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb_bolt 153640 424969 1422 13.17 5432 10877 65.6 65.6 19.2% 0.0% 0.0% 0.0% 23.40sec 424969 298.91sec
Venthyr_Nadjia Venthyr_Nadjia arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.23sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 254.36sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia deathly_eruption 322256 20264 68 2.94 1164 2327 14.7 14.7 18.7% 0.0% 0.0% 0.0% 1.78sec 20264 298.91sec
Venthyr_Nadjia Venthyr_Nadjia evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 181.49sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia frostbolt 116 1766 6 0.20 1481 2961 0.0 1.0 19.3% 0.0% 0.0% 0.0% 0.00sec 1766 298.91sec
Venthyr_Nadjia Venthyr_Nadjia mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia_mirror_image frostbolt 59638 6094 152 135.00 57 114 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6094 40.00sec
Venthyr_Nadjia Venthyr_Nadjia mirrors_of_torment 314793 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 129.17sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia agonizing_backlash 320035 20879 70 1.13 3101 6150 5.6 5.6 19.6% 0.0% 0.0% 0.0% 52.93sec 20879 298.91sec
Venthyr_Nadjia Venthyr_Nadjia tormenting_backlash 317589 26506 89 0.55 8046 16350 2.7 2.7 19.5% 0.0% 0.0% 0.0% 131.87sec 26506 298.91sec
Venthyr_Nadjia Venthyr_Nadjia potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 50.52sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 51.93sec 0 298.91sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi_explosion 210833 305770 1023 6.15 9982 0 6.1 30.6 0.0% 0.0% 0.0% 0.0% 51.81sec 305770 298.91sec
Venthyr_Nadjia Venthyr_Nadjia use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.41sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar arcane_barrage 44425 1741139 5825 56.95 5161 10270 56.8 283.7 19.2% 0.0% 0.0% 0.0% 5.26sec 1741139 298.91sec
Venthyr_Theotar Venthyr_Theotar arcane_echo 342232 135110 452 42.73 532 1063 42.6 212.9 19.3% 0.0% 0.0% 0.0% 6.55sec 135110 298.91sec
Venthyr_Theotar Venthyr_Theotar arcane_explosion 1449 2392689 8005 153.78 2617 5239 153.2 766.1 19.3% 0.0% 0.0% 0.0% 1.92sec 2392689 298.91sec
Venthyr_Theotar Venthyr_Theotar arcane_orb 153626 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.52sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar arcane_orb_bolt 153640 429031 1435 13.10 5516 11059 65.3 65.3 19.1% 0.0% 0.0% 0.0% 23.52sec 429031 298.91sec
Venthyr_Theotar Venthyr_Theotar arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.50sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.99sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar deathly_fixation 322253 0 0 0.00 0 0 14.8 0.0 0.0% 0.0% 0.0% 0.0% 1.75sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar deathly_eruption 322256 20507 69 2.96 1164 2327 14.8 14.8 19.5% 0.0% 0.0% 0.0% 1.75sec 20507 298.91sec
Venthyr_Theotar Venthyr_Theotar evocation 12051 0 0 0.00 0 0 0.8 0.0 0.0% 0.0% 0.0% 0.0% 172.45sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar frostbolt 116 1767 6 0.20 1481 2961 0.0 1.0 19.4% 0.0% 0.0% 0.0% 0.00sec 1767 298.91sec
Venthyr_Theotar Venthyr_Theotar mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar_mirror_image frostbolt 59638 6097 152 135.00 57 114 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6097 40.00sec
Venthyr_Theotar Venthyr_Theotar mirrors_of_torment 314793 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 138.15sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar agonizing_backlash 320035 19017 64 1.05 3044 6049 5.3 5.3 19.2% 0.0% 0.0% 0.0% 54.90sec 19017 298.91sec
Venthyr_Theotar Venthyr_Theotar tormenting_backlash 317589 24195 81 0.51 7969 16055 2.6 2.6 18.7% 0.0% 0.0% 0.0% 139.42sec 24195 298.91sec
Venthyr_Theotar Venthyr_Theotar potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 51.45sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi 321507 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 52.97sec 0 298.91sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi_explosion 210833 313094 1047 6.05 10400 0 6.0 30.1 0.0% 0.0% 0.0% 0.0% 52.89sec 313094 298.91sec
Venthyr_Theotar Venthyr_Theotar use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.83sec 0 298.91sec
arcane arcane arcane_barrage 44425 1735722 5807 57.15 5118 10214 57.0 284.7 19.2% 0.0% 0.0% 0.0% 5.26sec 1735722 298.91sec
arcane arcane arcane_echo 342232 116133 389 36.76 532 1062 36.6 183.1 19.3% 0.0% 0.0% 0.0% 7.67sec 116133 298.91sec
arcane arcane arcane_explosion 1449 2362424 7903 154.85 2567 5136 154.3 771.4 19.3% 0.0% 0.0% 0.0% 1.91sec 2362424 298.91sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.64sec 0 298.91sec
arcane arcane arcane_orb_bolt 153640 424146 1419 13.08 5462 10953 65.2 65.2 19.1% 0.0% 0.0% 0.0% 23.64sec 424146 298.91sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.41sec 0 298.91sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 256.69sec 0 298.91sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
arcane arcane deathly_fixation 322253 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 1.74sec 0 298.91sec
arcane arcane deathly_eruption 322256 20214 68 2.92 1164 2327 14.5 14.5 19.6% 0.0% 0.0% 0.0% 1.74sec 20214 298.91sec
arcane arcane evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 182.84sec 0 298.91sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
arcane arcane frostbolt 116 1772 6 0.20 1481 2961 0.0 1.0 19.6% 0.0% 0.0% 0.0% 0.00sec 1772 298.91sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
arcane arcane_mirror_image frostbolt 59638 6033 151 135.00 56 113 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6033 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 298.91sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 51.03sec 0 298.91sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.45sec 0 298.91sec
arcane arcane touch_of_the_magi_explosion 210833 201116 673 6.11 6609 0 6.1 30.4 0.0% 0.0% 0.0% 0.0% 52.32sec 201116 298.91sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.35sec 0 298.91sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
49595.1 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 37.9sec 7.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 102.8s

Stack Uptimes

  • Health Decade (0 - 10)_1:7.89%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 21.8sec 6.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.4s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.19%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 23.3sec 7.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 35.0s

Stack Uptimes

  • Health Decade (20 - 30)_1:7.55%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 29.2sec 9.80% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.9s / 40.8s

Stack Uptimes

  • Health Decade (30 - 40)_1:9.80%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.7sec 11.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.8s / 46.2s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.27%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 38.3sec 12.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.4s / 52.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.91%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 39.7sec 13.48% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:33.6s / 47.8s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.48%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 44.9sec 15.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:34.9s / 53.5s

Stack Uptimes

  • Health Decade (70 - 80)_1:15.22%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 33.3sec 11.29% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 50.4s

Stack Uptimes

  • Health Decade (80 - 90)_1:11.29%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.7sec 4.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.9s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.49%
Mirrors of Torment 2.7 0.0 137.4sec 138.7sec 13.2sec 11.77% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 165.8s
  • trigger_min/max:97.1s / 165.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.17%
  • mirrors_of_torment_2:5.26%
  • mirrors_of_torment_3:1.33%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Mirrors of Torment 2.9 0.0 128.2sec 129.3sec 13.2sec 12.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 162.6s
  • trigger_min/max:93.8s / 162.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.55%
  • mirrors_of_torment_2:5.67%
  • mirrors_of_torment_3:1.44%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Radiant Spark Vulnerability 9.3 27.5 33.2sec 7.9sec 4.8sec 14.89% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 59.5s
  • trigger_min/max:0.5s / 54.0s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.87%
  • radiant_spark_vulnerability_2:3.74%
  • radiant_spark_vulnerability_3:3.54%
  • radiant_spark_vulnerability_4:3.74%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Radiant Spark Vulnerability 9.3 27.3 33.4sec 7.9sec 4.8sec 14.84% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 59.5s
  • trigger_min/max:0.5s / 54.0s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.84%
  • radiant_spark_vulnerability_2:3.73%
  • radiant_spark_vulnerability_3:3.52%
  • radiant_spark_vulnerability_4:3.75%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Touch of the Magi 6.1 0.0 52.2sec 52.4sec 7.9sec 16.21% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 73.6s
  • trigger_min/max:46.3s / 73.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.21%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.2sec 7.9sec 17.24% 0.00% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 57.8s
  • trigger_min/max:39.0s / 57.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.24%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.2sec 7.9sec 17.24% 0.00% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 59.0s
  • trigger_min/max:35.0s / 59.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.24%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.2sec 7.9sec 17.24% 0.00% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 58.0s
  • trigger_min/max:35.0s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.24%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.2sec 7.9sec 17.24% 0.00% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 57.9s
  • trigger_min/max:35.1s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.24%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.0 0.0 52.8sec 53.0sec 7.9sec 16.01% 0.00% 0.0 (0.0) 5.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 73.6s
  • trigger_min/max:46.3s / 73.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.01%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 51.7sec 51.9sec 7.9sec 16.29% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 71.6s
  • trigger_min/max:46.3s / 71.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.29%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.2sec 54.4sec 7.9sec 15.66% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 76.2s
  • trigger_min/max:47.4s / 76.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.66%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.5sec 54.6sec 7.9sec 15.61% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 76.2s
  • trigger_min/max:47.4s / 76.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.61%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.0 0.0 52.8sec 53.0sec 7.9sec 16.00% 0.00% 0.0 (0.0) 5.9

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 73.6s
  • trigger_min/max:46.3s / 73.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.00%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.0 0.0 52.9sec 53.0sec 7.9sec 16.00% 0.00% 0.0 (0.0) 5.9

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 73.6s
  • trigger_min/max:46.3s / 73.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.00%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
Fluffy_Pillow Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1018
Mean 52492.59
Minimum 50013.27
Maximum 55094.59
Spread ( max - min ) 5081.32
Range [ ( max - min ) / 2 * 100% ] 4.84%
Standard Deviation 953.0897
5th Percentile 51073.95
95th Percentile 54019.58
( 95th Percentile - 5th Percentile ) 2945.63
Mean Distribution
Standard Deviation 29.8717
95.00% Confidence Interval ( 52434.05 - 52551.14 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1267
0.1 Scale Factor Error with Delta=300 7755
0.05 Scale Factor Error with Delta=300 31018
0.01 Scale Factor Error with Delta=300 775446
HPS
Fluffy_Pillow Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 183
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 17385403 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
32098.3 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 41.2sec 8.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 114.0s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.01%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 23.8sec 6.92% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 39.2s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.93%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.2sec 8.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 37.5s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.70%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.3sec 10.84% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.1s / 41.7s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.84%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.7sec 11.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.4s / 45.1s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.68%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.1sec 11.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.6s / 51.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.88%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.2sec 12.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.1s / 41.9s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.63%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.3sec 14.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.8s / 49.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.01%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 29.1sec 9.84% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.4s / 44.2s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.84%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.7sec 4.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.50%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1922
death count pct 185.88
avg death time 298.37
min death time 240.12
max death time 357.21
dmg taken 10154168.99

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
enemy2 Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1018
Mean 33984.66
Minimum 32863.85
Maximum 35345.77
Spread ( max - min ) 2481.92
Range [ ( max - min ) / 2 * 100% ] 3.65%
Standard Deviation 493.6750
5th Percentile 33226.04
95th Percentile 34783.47
( 95th Percentile - 5th Percentile ) 1557.44
Mean Distribution
Standard Deviation 15.4727
95.00% Confidence Interval ( 33954.34 - 34014.99 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9
0.1% Error 811
0.1 Scale Factor Error with Delta=300 2081
0.05 Scale Factor Error with Delta=300 8322
0.01 Scale Factor Error with Delta=300 208050
HPS
enemy2 Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 183
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 10503695 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
32047.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 41.3sec 9.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 118.2s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.10%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.2sec 6.95% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 36.5s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.95%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.5sec 8.74% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.0s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.74%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.1sec 10.80% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.3s / 40.9s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.80%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.7sec 11.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.6s / 44.8s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.68%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 34.9sec 11.82% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.4s / 51.0s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.82%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.3sec 12.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.1s / 42.7s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.65%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.3sec 14.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.4s / 49.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.01%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 28.9sec 9.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 44.8s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.81%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.7sec 4.48% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.48%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1922
death count pct 185.88
avg death time 298.37
min death time 240.12
max death time 357.21
dmg taken 10151643.48

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
enemy3 Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1018
Mean 33976.10
Minimum 32565.37
Maximum 35244.18
Spread ( max - min ) 2678.81
Range [ ( max - min ) / 2 * 100% ] 3.94%
Standard Deviation 486.2306
5th Percentile 33227.12
95th Percentile 34755.54
( 95th Percentile - 5th Percentile ) 1528.42
Mean Distribution
Standard Deviation 15.2394
95.00% Confidence Interval ( 33946.23 - 34005.96 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 787
0.1 Scale Factor Error with Delta=300 2019
0.05 Scale Factor Error with Delta=300 8073
0.01 Scale Factor Error with Delta=300 201822
HPS
enemy3 Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 183
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 11638914 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
32014.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 43.2sec 9.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 123.1s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.15%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 23.8sec 6.75% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.0s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.76%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.4sec 8.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 36.7s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.65%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.3sec 10.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.6s / 42.2s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.86%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.2s / 45.3s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.67%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.0sec 11.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.1s / 50.5s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.86%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.3sec 12.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.8s / 41.4s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.64%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.4sec 14.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.8s / 49.6s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.05%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 29.2sec 9.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.9s / 44.2s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.91%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.7sec 4.51% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.51%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1922
death count pct 185.88
avg death time 298.37
min death time 240.12
max death time 357.21
dmg taken 10153371.90

Statistics & Data Analysis

Fight Length
enemy4 Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
enemy4 Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy4 Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy4 Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy4 Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy4 Damage Taken Per Second
Count 1018
Mean 33981.04
Minimum 32800.74
Maximum 35509.84
Spread ( max - min ) 2709.10
Range [ ( max - min ) / 2 * 100% ] 3.99%
Standard Deviation 492.5866
5th Percentile 33227.69
95th Percentile 34785.79
( 95th Percentile - 5th Percentile ) 1558.10
Mean Distribution
Standard Deviation 15.4386
95.00% Confidence Interval ( 33950.78 - 34011.30 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9
0.1% Error 808
0.1 Scale Factor Error with Delta=300 2072
0.05 Scale Factor Error with Delta=300 8286
0.01 Scale Factor Error with Delta=300 207133
HPS
enemy4 Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy4 Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy4 Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy4 Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy4 Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy4Theck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy4 Max Spike Value
Count 183
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 11273119 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy4"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
32678.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 43.5sec 9.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 110.3s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.69%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.1sec 7.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 36.9s

Stack Uptimes

  • Health Decade (10 - 20)_1:7.08%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 27.3sec 8.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 37.8s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.99%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 33.2sec 11.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.7s / 42.8s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.16%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.1sec 11.83% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.9s / 46.4s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.83%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.6sec 12.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.2s / 52.1s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.06%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 38.6sec 13.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.8s / 43.8s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.09%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.5sec 14.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.6s / 52.4s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.07%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 23.6sec 8.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.3s / 41.8s

Stack Uptimes

  • Health Decade (80 - 90)_1:8.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 16.6sec 4.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.10%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1922
death count pct 185.88
avg death time 298.37
min death time 240.12
max death time 357.21
dmg taken 10393642.81

Statistics & Data Analysis

Fight Length
enemy5 Fight Length
Count 1018
Mean 298.91
Minimum 240.05
Maximum 359.92
Spread ( max - min ) 119.86
Range [ ( max - min ) / 2 * 100% ] 20.05%
DPS
enemy5 Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy5 Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy5 Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy5 Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy5 Damage Taken Per Second
Count 1018
Mean 34786.95
Minimum 33548.93
Maximum 35881.94
Spread ( max - min ) 2333.00
Range [ ( max - min ) / 2 * 100% ] 3.35%
Standard Deviation 471.3567
5th Percentile 34007.25
95th Percentile 35501.68
( 95th Percentile - 5th Percentile ) 1494.43
Mean Distribution
Standard Deviation 14.7732
95.00% Confidence Interval ( 34757.99 - 34815.90 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 706
0.1 Scale Factor Error with Delta=300 1897
0.05 Scale Factor Error with Delta=300 7587
0.01 Scale Factor Error with Delta=300 189664
HPS
enemy5 Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy5 Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy5 Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy5 Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy5 Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy5Theck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy5 Max Spike Value
Count 183
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 12611372 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy5"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.